(data stored in ACNUC9435 zone)

EMBL: CP000031.MOBB

CP000031.MOBB        Location/Qualifiers
FT   CDS_pept        321251..321742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mobB"
FT                   /locus_tag="SPO0308"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein B"
FT                   /note="identified by similarity to SP:P32125; match to
FT                   protein family HMM PF03205; match to protein family HMM
FT                   TIGR00176"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93626"
FT                   /db_xref="GOA:Q5LX90"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX90"
FT                   /protein_id="AAV93626.1"
FT                   /translation="MRIYGVTGWKNAGKTGLMERLVAEITGRGLTVSTVKHAHHSFDVD
FT                   HPGRDSWRHRQAGASEVILASRYRVAQMTELRGAAEPPLSELLGRLSPVDLVLIEGYKR
FT                   EGHPKVEAFRAEAGTALIAPGDPTIRAVASDTPLTLDRPVFDLNDTTAIADFILSEVGL
FT                   "
     atgaggatct atggcgtcac cggctggaag aacgcaggca agaccgggct gatggagcgt        60
     ctggtggccg agatcaccgg gcgggggctg acggtttcga cggtcaagca tgcgcatcat       120
     tcgttcgacg tcgaccatcc gggccgcgac agctggcggc accggcaggc gggggcctcc       180
     gaggtgatcc ttgcctcacg ctatcgcgtg gcgcagatga ccgaattgcg cggcgcggcg       240
     gaaccgccgt tgagcgagct gctggggcgt ctgtcgcctg tcgatctggt gctgatcgag       300
     ggttacaagc gtgagggcca tcccaaggtg gaggcattcc gcgccgaagc ggggaccgct       360
     ttgatcgcgc cgggtgatcc gaccatacgg gcggtggcaa gtgatacgcc cctgacgctt       420
     gaccggccgg tgttcgacct gaacgacaca accgcgattg ccgatttcat cctctccgag       480
     gtcgggctgt ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page