(data stored in ACNUC7421 zone)

EMBL: CP000031.MOTA

CP000031.MOTA        Location/Qualifiers
FT   CDS_pept        219941..220810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motA"
FT                   /locus_tag="SPO0203"
FT                   /product="chemotaxis protein MotA"
FT                   /note="identified by similarity to SP:P09348; match to
FT                   protein family HMM PF01618"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93529"
FT                   /db_xref="GOA:Q5LX01"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX01"
FT                   /protein_id="AAV93529.1"
FT                   /translation="MIGILGIVVIFVMVFGGYLAAGGKMTIILKSLPFEMMMIGGAATG
FT                   AFLISNDMGGVKHTLKDVGKVFKGPKWKPEDYRDLLCLLFSLIRIARQNPVEVEQHIED
FT                   PASSALFSKYPRIQADHEAVDLICDTMRSASMNYDDPHQVEEVLEKRMEANLHHAMHSS
FT                   HALQTVADGLPALGIVAAVLGVIKTMGSIDQPPEVLGRLIGGALVGTFLGVFLAYGLVG
FT                   PFASKVKAVVEEDNHFYLLIKEVLVANLHNHNPAMCIEVGRQNTPSHIRPGFTDLEQAL
FT                   KDLKQDAA"
     atgatcggca tccttggtat cgttgtcatc tttgtgatgg tcttcggcgg ctatctcgcg        60
     gccggtggca agatgacgat catcctcaaa tccctgcctt tcgagatgat gatgatcggt       120
     ggcgcagcga caggcgcctt tctcatttcc aacgatatgg gcggggtgaa gcatacgctc       180
     aaggatgtcg gaaaggtatt caagggcccg aaatggaagc ccgaggatta tcgggatctg       240
     ctctgcctat tgttttcgct gatccggatc gcgcgacaga atcctgtcga ggtcgagcag       300
     catatcgagg atccggcgag ttctgcgctg ttctccaaat acccgcgaat ccaggccgat       360
     cacgaagcgg tggacctgat ctgcgacacc atgcgatcgg cgtcgatgaa ctatgacgat       420
     ccccatcagg tcgaagaagt tctggaaaaa cggatggagg cgaacctgca tcatgcgatg       480
     cattccagcc atgcgctcca gaccgtcgcc gacggcttgc ccgccctggg gatcgttgcc       540
     gccgttttgg gcgtcatcaa gacaatgggg tcgatcgacc agccgcccga ggttcttggc       600
     agactgatcg gcggcgcgct ggtcgggacg tttctggggg tgttcctcgc ctatgggctg       660
     gttggcccct ttgcatccaa ggtcaaggcc gttgtcgaag aagacaatca tttctatctg       720
     ctgatcaagg aggtgcttgt cgccaatctg cacaaccaca acccggcgat gtgcatcgaa       780
     gtcggacgac agaatacgcc ctctcatatt cgtcccggct tcaccgattt ggagcaggcc       840
     ctgaaagacc tcaaacagga cgcggcgtga                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page