(data stored in ACNUC7421 zone)

EMBL: CP000031.MOTB

CP000031.MOTB        Location/Qualifiers
FT   CDS_pept        209006..209863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="SPO0191"
FT                   /product="chemotaxis protein MotB"
FT                   /note="identified by similarity to SP:P09349"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93517"
FT                   /db_xref="GOA:Q5LWX9"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWX9"
FT                   /protein_id="AAV93517.1"
FT                   /translation="MIMKVVEMGAHTNAAPIIIKKKKSGGGDGHHGGAWKVAYADFVTA
FT                   MMAFFMLMWLLNATTEKQRKGLADYFSDSIPINPVSGGGDGSFGGDSMFSENAMVTTGT
FT                   GGVNRRRADADRSRGSTGVDRQGGEGEPLEEFKTLEAALQGRGGESLVSEQLRKHIVTR
FT                   VTDEGLIVELISTDESPLFETNSDRPTQLMKELAKVVVRAADMVSNGIAVGGHIRAHPV
FT                   VLARNPVWELSTARAERTRVLFEGLGMKEERIQRVTGHADRKLTDPNPMAARNDRIEII
FT                   FLRS"
     gtgataatga aggtggtgga gatgggtgcg cataccaatg cggcgccaat catcatcaag        60
     aagaagaaat cgggtggcgg cgatggccac cacggtggcg catggaaggt ggcttatgcc       120
     gacttcgtga ccgccatgat ggccttcttc atgttgatgt ggctgctgaa cgcgacgact       180
     gaaaaacaac gcaagggcct ggccgactat ttctcggatt ccattccgat caacccggtt       240
     tcgggtggag gtgacggctc ctttggcggc gacagcatgt tttcggaaaa cgcgatggtc       300
     acgaccggga ctggtggtgt gaatcgtcgc cgcgcggatg cggaccgctc gcgcggctcg       360
     accggggtcg accggcaggg tggcgaggga gagccgcttg aagagttcaa gacgctcgag       420
     gccgccttgc agggccgggg cggggaaagc ctggtttccg aacaattgcg caagcatatc       480
     gtgacgcggg tgaccgatga gggattgatc gtcgaactga tctcgacgga cgaatcgccc       540
     ctgttcgaaa ccaattccga ccgtccaacc caattgatga aggaactggc caaggtggtt       600
     gtccgtgccg cggacatggt gtcgaacggg attgcggtgg gtggtcatat ccgggcgcat       660
     ccagtggttc tggcgcgaaa tccggtctgg gaactgtcca cggcacgggc cgaacggacc       720
     cgtgtcctgt tcgaagggtt gggaatgaaa gaagagcgta ttcagcgcgt taccgggcac       780
     gcggatcgca agttgaccga tccaaatccg atggccgcgc gcaacgaccg gatcgagatc       840
     atctttctgc ggagttga                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page