(data stored in ACNUC9435 zone)

EMBL: CP000031.MREB

CP000031.MREB        Location/Qualifiers
FT   CDS_pept        complement(433204..434250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /locus_tag="SPO0420"
FT                   /product="rod shape-determining protein MreB"
FT                   /note="identified by similarity to SP:P13519; match to
FT                   protein family HMM PF06723; match to protein family HMM
FT                   TIGR00904"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93738"
FT                   /db_xref="GOA:Q5LWC2"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWC2"
FT                   /protein_id="AAV93738.1"
FT                   /translation="MGFFDNLSGLFAADMAIDLGTANTLVYVKGRGIILSEPSVVAYHV
FT                   KDGVKKVLAVGEDAKLMLGRTPGSIEAIRPMREGVIADFDTAEEMIKHFIRKVHKRSTF
FT                   SKPKIIVCVPHGATPVEKRAIRQSVLSAGARRAGLIAEPIAAAIGAGMPITDPTGNMVV
FT                   DIGGGTTEVAVLSLGDIVYARSVRVGGDRMDEAIISYLRRQQNLLVGESTAERIKTSIG
FT                   TARMPDDGRGQSMLIRGRDLLNGVPKEIEISQAQVAEALAEPVQQICEAVMTALETTPP
FT                   DLAADIVDRGVMLTGGGALLGDLDLALREQTGLAVSIADESLNCVALGTGKALEYEKQL
FT                   RHAIDYDS"
     atggggttct ttgacaattt gagtggtctg ttcgcagcgg acatggccat cgacctggga        60
     accgccaaca cgctggtcta tgtcaaggga cggggcatca tcctgtccga accctcggtg       120
     gtggcctatc acgtcaagga cggggtcaag aaggttctcg ccgtgggcga ggatgctaag       180
     ctgatgctgg gccgaacccc gggcagcatc gaggcgatcc gcccgatgcg cgaaggcgtg       240
     atcgccgatt tcgacaccgc cgaagagatg atcaagcatt tcatccgcaa ggtgcacaaa       300
     cgctcgacct tctcgaaacc caagatcatc gtctgcgtcc cccatggcgc caccccggtg       360
     gaaaagcgcg cgatccgtca gtcggtgctg agcgccggcg cccgccgcgc gggcctgatc       420
     gccgaaccca tcgcggcggc catcggggcc ggcatgccga tcaccgaccc gaccggcaac       480
     atggttgtcg atatcggcgg cggcaccacc gaggtggccg tcctgtcgct gggtgacatc       540
     gtctatgccc gctcggtccg cgtcggcggc gaccggatgg acgaggcgat catcagctac       600
     ctgcgccgtc agcagaacct gctggtgggc gaaagcaccg ccgaacgcat caagacctcg       660
     atcggaaccg cgcgcatgcc cgatgacggg cgcggccagt cgatgctgat ccggggtcgc       720
     gacctgctca atggcgtgcc aaaggagatc gagatcagcc aggcccaggt ggccgaggcg       780
     ctggccgaac cggtgcagca gatctgcgag gcggtgatga ccgcgctgga gaccacgccg       840
     cccgatctgg cagccgatat cgtcgaccgg ggcgtcatgc tgaccggcgg cggtgcgctg       900
     ctgggcgatc ttgacctggc cctgcgcgaa cagaccgggc tggcggtttc gattgccgat       960
     gaaagcctga actgtgtggc actcggcacc ggcaaggcgc tggaatacga aaagcagctg      1020
     cgccacgcga ttgactacga cagctaa                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page