(data stored in ACNUC7421 zone)

EMBL: CP000031.MREC

CP000031.MREC        Location/Qualifiers
FT   CDS_pept        complement(432207..433142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreC"
FT                   /locus_tag="SPO0419"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="identified by similarity to SP:P16926; match to
FT                   protein family HMM PF04085; match to protein family HMM
FT                   TIGR00219"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93737"
FT                   /db_xref="GOA:Q5LWC3"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWC3"
FT                   /protein_id="AAV93737.1"
FT                   /translation="MAERTSLARDRSQREDYAGPLRRLLLGVLLLCLLGIFLVWRIDSP
FT                   RVERFRAQVVDTVIPSMDWAMVPVTGTINLIRDFQSYQRLSEQNRELRSELRQMRAWKE
FT                   AALQLEQENARLLDLNNVRLDPRLTYITGVVMADSGSPFRQSVLLNVGARDGIVDGWAA
FT                   MDGIGLVGRISGVGQSSARVILLTDAASSIPATIQPSGQTALITGDNTAAPVVDFLENR
FT                   ELVRPGDRVVTSGDGGVFPAGLLIGQVAEDRTGRLRVRLSADYERLEFLRVLRHHGTEK
FT                   IEDHGDVVGPPAPAAPDTSALTTPAEATDG"
     ttggcggaaa ggacctcttt ggcacgcgac cgctcacagc gcgaggacta tgccggcccc        60
     ctgcgccgcc tgttgctcgg ggttctgctg ctgtgtctgc tgggcatctt tctggtctgg       120
     cgcatcgaca gcccgcgggt cgaacgcttc cgcgcccagg tcgtcgacac ggtcatcccc       180
     tcgatggact gggccatggt gccggtcacc ggcaccatca acctgatccg cgatttccag       240
     agctatcagc ggctgagcga gcagaaccgc gagctgcgca gcgagctgcg ccagatgcgc       300
     gcctggaaag aggccgcgct gcaactggaa caggaaaacg cccggctgct ggacctgaac       360
     aatgtccgcc tcgatccgcg cctgacctat atcaccggcg tagtgatggc cgatagcggc       420
     tctcccttcc ggcaatcggt gctgctgaac gtgggcgcgc gcgacgggat cgtcgatggc       480
     tgggccgcga tggacgggat cgggctggtg ggccggatct cgggcgtggg gcaatcctcg       540
     gcccgggtca tcctgctgac cgacgcggcc agttcgatcc ccgccaccat ccagccctcg       600
     gggcagaccg cgctgatcac cggcgacaac accgctgccc cggtggtcga tttcctggag       660
     aaccgcgagc ttgtccgtcc cggcgaccgg gtggtcacct cgggtgatgg cggcgtgttt       720
     cccgccggtc tcttgatcgg acaggtggcc gaggaccgga ccgggcgcct gcgcgtacgc       780
     ctgtcggccg attacgaacg gctggagttc ctgcgcgtgc tgcgtcatca cggcaccgag       840
     aagatcgaag atcacggcga cgtggtcggc ccaccggccc ccgccgcgcc cgatacctcg       900
     gcgctgacca ccccagcgga ggccaccgat ggatag                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page