(data stored in ACNUC7421 zone)

EMBL: CP000031.MSRA-1

CP000031.MSRA-1      Location/Qualifiers
FT   CDS_pept        complement(14726..15388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA-1"
FT                   /locus_tag="SPO0014"
FT                   /product="methionine-S-sulfoxide reductase"
FT                   /EC_number="1.8.4.-"
FT                   /note="identified by similarity to SP:Q93P63; match to
FT                   protein family HMM PF01625; match to protein family HMM
FT                   TIGR00401"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93345"
FT                   /db_xref="GOA:Q5LWG7"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWG7"
FT                   /protein_id="AAV93345.1"
FT                   /translation="MFPIQTLKPIALIAAMALATILQGGKAEAAETQTLTVAGGCFWCV
FT                   EADFEKVPGVLGAVSGYTGGTLDNPTYKQVTRGGTGHFEAVQILFDPDQVSRERLLHMF
FT                   FRSVDPTDAGGQFCDRGDSYRTAIFVSNKVESALASQAKANAEAELGQTVVTPILTAGR
FT                   FYPAEAYHQDYAKGEKLVLTRFGPKRQQEAYKLYRKSCGRDARVKQLWGDAAPFAGS"
     atgttcccga tccagacact caaacccatt gccctgatcg ccgccatggc cctggccacc        60
     atcctgcaag ggggcaaggc agaggccgca gagacccaga ccctgaccgt tgcgggtggc       120
     tgtttctggt gtgtcgaggc cgatttcgag aaagtgcccg gcgtgctggg cgcggtgtcc       180
     ggttatactg gcgggacact cgacaacccg acctacaagc aggtcacgcg cggcggcacc       240
     gggcattttg aggcggtgca gatcctgttc gacccggatc aggtttcacg cgaacgcctg       300
     ctgcatatgt ttttccgctc ggtcgaccca accgatgcag gcggccagtt ctgtgatcgc       360
     ggtgacagct atcgcaccgc gatattcgtc tctaacaagg tggaaagtgc gttggcatct       420
     caggccaaag ccaacgcaga agcggaactg ggccaaactg tcgtgacccc gatcctgacg       480
     gcgggccggt tttatccggc cgaggcctat catcaggact atgccaaggg agaaaagctg       540
     gtgctgaccc ggttcggccc gaaacggcag caagaggcct acaagctcta tcgcaaatcc       600
     tgtggccgcg atgcgcgggt gaaacagctt tggggggatg cggcgccctt tgcgggcagc       660
     tag                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page