(data stored in ACNUC9435 zone)

EMBL: CP000031.MUTM

CP000031.MUTM        Location/Qualifiers
FT   CDS_pept        161604..162455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="SPO0146"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="identified by match to protein family HMM PF01149;
FT                   match to protein family HMM PF06831; match to protein
FT                   family HMM TIGR00577"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93474"
FT                   /db_xref="GOA:Q5LWT9"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWT9"
FT                   /protein_id="AAV93474.1"
FT                   /translation="MPELPEVETVRRGLAPAMEGAVIARAEVNRPDLRWPFPDRMAERL
FT                   TGQRVERLRRRSKYILADLSGGETLLIHLGMSGRMTVSGDPLGQFVHDHPAAQKHDHVV
FT                   FHMDNGARITFNDPRRFGAMDLMATATADEHKLLMVLGPEPLGNDFHEDYLVAALKGRN
FT                   TPVKSALLDQGIVAGLGNIYVCEALFRAGVSPRRKAGQIAAARVSALVPIIRQVLSEAI
FT                   EAGGSSLKDFRQADGELGYFQHSFDVYGREGEPCRRAGCDGTVQRITQSGRSSFYCAQC
FT                   QR"
     atgcctgaat tgcccgaggt cgagaccgtg cggcgcggat tggcccccgc gatggagggg        60
     gcggtgatcg cgcgggccga agtcaatcgg cccgacctgc gctggccttt ccccgatcgc       120
     atggccgagc ggctgacagg ccagcgggtc gaacggctgc ggcggcggtc gaaatacatc       180
     ctggccgatc tgtcgggggg cgagacgctg ttgatccatc tgggcatgtc ggggcggatg       240
     accgtgtcgg gtgacccgct ggggcagttc gtgcatgacc acccggcggc gcagaaacat       300
     gaccatgtgg tgtttcacat ggacaacggc gcccgcatca ccttcaacga cccgcgccgg       360
     ttcggtgcga tggacctgat ggccaccgca accgcggatg aacacaagct gttgatggtg       420
     ctgggccccg agccgctggg caacgatttt cacgaggatt acctggttgc cgccctcaag       480
     ggccgcaaca cgccggtgaa atctgcgctg ctggatcagg gaatcgtggc ggggctgggc       540
     aatatctatg tctgcgaggc gctgttccgg gccggggtgt cgccgcgtcg caaggcggga       600
     cagatcgccg ccgcgcgggt ctctgcgctg gttccgatca ttcgccaggt cctgtccgag       660
     gcgatcgagg cgggtggatc ctcgctcaag gatttccgcc aagccgatgg agaacttggg       720
     tattttcagc acagcttcga tgtctacggg cgcgaggggg aaccctgccg ccgcgcgggc       780
     tgtgacggca cggtgcagag aatcacccag tccggacgct catccttcta ttgcgcgcaa       840
     tgccaaagat aa                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page