(data stored in ACNUC9435 zone)

EMBL: CP000031.MUTT

CP000031.MUTT        Location/Qualifiers
FT   CDS_pept        61973..62371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="SPO0060"
FT                   /product="mutator mutT protein"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00293;
FT                   match to protein family HMM TIGR00586"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93391"
FT                   /db_xref="GOA:Q5LWL5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWL5"
FT                   /protein_id="AAV93391.1"
FT                   /translation="MKTVLVSAVALIDVDGRVLLAQRPEGKSMAGLWEFPGGKVEPGET
FT                   PEVALIRELHEELGINTWASCLAPLTFASHGYDDFHLLMPLFACRKWEGIPQSREGQAL
FT                   KWVRATELRNYPMPPADVPLIPILRDWL"
     gtgaaaaccg tccttgtttc cgccgtcgcg ctgatcgacg tggatggccg ggtgctgctg        60
     gcgcagcgcc cggaaggcaa gtcgatggcg ggcctgtggg agtttcccgg cggcaaggtc       120
     gaacccggag agacacccga agtggcgctg attcgcgagc tgcacgagga gctggggatc       180
     aatacctggg cctcgtgcct ggcgccactg acctttgcca gccatggcta tgacgatttc       240
     cacctgctga tgccgctgtt tgcctgccgc aaatgggaag gtatcccgca atctcgcgaa       300
     ggtcaggcgc tgaaatgggt gcgtgccacc gagttgcgca actatccgat gccgcctgcg       360
     gatgttccgc tgatcccgat cctgcgagat tggctgtaa                              399
//

If you have problems or comments...

PBIL Back to PBIL home page