(data stored in ACNUC9435 zone)

EMBL: CP000031.MVIN

CP000031.MVIN        Location/Qualifiers
FT   CDS_pept        complement(406792..408333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mviN"
FT                   /locus_tag="SPO0396"
FT                   /product="integral membrane protein MviN"
FT                   /note="identified by similarity to SP:O05467; match to
FT                   protein family HMM PF03023; match to protein family HMM
FT                   TIGR01695"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93714"
FT                   /db_xref="GOA:Q5LWE6"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWE6"
FT                   /protein_id="AAV93714.1"
FT                   /translation="MKPIRLMAGFFTVGFWTLASRILGFAREILLAAYIGPGPVMDAFV
FT                   AAFRLPNLFRRFFAEGAFNAAFVPMFSKRLEGGEDAEGFAQQAFNLLGAAVLTLVALAM
FT                   IFMPALIWATASGFVGDERFDLAVGYGKIAFPYILFMSLAALFSGVLNATGRFAAAAAA
FT                   PVLLNVFACAAMLAGSALGGEVIDWLIWVIPVAGVAQLALVWVAAERAGIRLRPGLPRL
FT                   SPAMRRLVRVAFPAALAMGVTQINLVVGQLVASRTESAVSWLFTADRLYQLPLGVVGIA
FT                   VGIVLLPDLSRRLRAGDDTGAREAYSRAGEFSLILTLPSAMALMAIPLPLVAVLFQRGA
FT                   FTPEDSAATAIAVAIYGLGLPAFMLQKVFQPLFFAREDTKSPFRYAVVAMVINAVLAFA
FT                   LYPLLGWIAPAIATTVAGWTMVAQLALGARRMGEVARFDTRFHGRAWRILMASLIMGAA
FT                   LYAVLIPLGWVFDLPSWRYLGLLALILFAAVVYFGVGHLIGAFRLSEFRRALRRS"
     atgaaaccga tccgcctgat ggccggtttc ttcacggtcg gattctggac gctggccagc        60
     cgtatccttg gctttgcgcg cgaaatcctg ctggccgcct acatcggccc cggcccggtg       120
     atggatgcct ttgtcgcggc ctttcgcctg cccaacctgt tccgccgctt ctttgccgag       180
     ggcgcgttca acgcggcctt tgtgccgatg ttctcgaagc ggctcgaagg gggcgaggat       240
     gccgagggct ttgcccagca ggcgttcaac ttgctgggcg cggcggtgct gaccctggtg       300
     gcgctggcca tgatcttcat gccggcgctg atctgggcca ccgccagcgg ctttgtcggg       360
     gacgagcggt tcgacctggc ggtgggctat ggcaagatcg cctttcccta tatcctgttc       420
     atgtcgctgg cggcgctgtt ctccggggtg ctgaacgcca ccgggcggtt tgccgccgct       480
     gccgccgcgc cggttctgct gaacgttttc gcctgcgccg cgatgctggc gggctcggcc       540
     ctgggtggcg aagtgatcga ctggctgatc tgggtgatcc ctgtcgcggg cgtggcgcag       600
     ctggcgctgg tctgggtcgc ggccgaacgt gcgggcatcc ggctgcgccc cggtcttccc       660
     cggctcagcc ccgctatgcg gcggctggta cgggtggcct ttcccgccgc gctggcgatg       720
     ggggtgacgc agatcaacct ggtggtcggg cagctcgtcg cctcgcgcac cgaaagcgcg       780
     gtcagctggc tgtttaccgc ggaccggctc tatcaactgc cgctgggcgt ggtgggcatt       840
     gcggtgggca tcgtgctgtt gcccgacctg tcgcgccgcc tgcgcgccgg cgacgacacc       900
     ggcgcgcgcg aggcctattc gcgcgcgggc gaattctctc tgatcctgac cctgccttcg       960
     gcaatggcgc tgatggcgat cccgctgccg ctggtcgcgg tgctgttcca gcgcggcgcc      1020
     tttacacccg aggacagcgc cgccaccgct atcgcagtgg cgatctacgg gctgggcctc      1080
     cccgcgttca tgctgcaaaa ggtgttccag ccgctgttct ttgcccgcga ggataccaag      1140
     agcccgttcc gctatgcggt ggtcgccatg gtgatcaacg cggtgctggc ctttgcgctt      1200
     tatccgctgc tgggctggat cgcacccgcc atagccacca cagtcgcggg ctggaccatg      1260
     gtggcccagc tggccctggg tgcgcgccgc atgggcgagg tggcccggtt cgacacccgc      1320
     ttccacggcc gcgcctggcg tatcctgatg gcctcgctga tcatgggggc ggcgctctat      1380
     gcggtgctga tcccgctcgg ctgggtgttc gacctgccca gctggcgtta tctgggcctg      1440
     ttggcgctga tcctctttgc ggccgtggtc tatttcgggg tcggccatct gatcggcgcc      1500
     ttccgcctgt cggaattccg ccgcgccttg aggcggtcat ga                         1542
//

If you have problems or comments...

PBIL Back to PBIL home page