(data stored in ACNUC9435 zone)

EMBL: CP000031.NADE

CP000031.NADE        Location/Qualifiers
FT   CDS_pept        440542..442200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="SPO0426"
FT                   /product="glutamine-dependent NAD(+) synthetase"
FT                   /EC_number="6.3.5.1"
FT                   /note="identified by similarity to SP:Q03638; match to
FT                   protein family HMM PF00795; match to protein family HMM
FT                   PF02540; match to protein family HMM TIGR00552"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93744"
FT                   /db_xref="GOA:Q5LWB6"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWB6"
FT                   /protein_id="AAV93744.1"
FT                   /translation="MADRFRITLAQLNPTVGDLAGNAAKARMAWEHGREAGADLVALPE
FT                   MFVTGYNTQDLVLKPVFHDAAIAMIEALAEECADGPALAIGGPLVEEGKLYNAYLILKG
FT                   GKIVSRSLKTHLPNETVFDEVRIFDAGPLGGPYSVGNTRIGSPICEDAWHEDVAETLAE
FT                   TGAEFLLVPNGSPYYRDKYDMRINQMVARVVETGLPLIYLNMVGGQDDQVFDGGTFGLN
FT                   PGGALAFRMPVFDEAITHVDLERGSEGWQIVQGEVAPLPDAWEQDYRVMVESLRDYMRK
FT                   TGFAKVLLGLSGGVDSALVAAIATDALGPENVRCVMLPSEYTSRSSLDDAEAVAQALGV
FT                   RYDYVPISESRAAVTNTLAPLFAGTEPGLTEENIQSRLRGLLLMALSNKFGEMLLTTGN
FT                   KSEVAVGYATIYGDMAGGYNPIKDLYKTRVFETCRWRNANHRLWMMGPAGEVIRPSVID
FT                   KPPSAELREDQKDSDSLPDYPELDAILDILVDQDGSIADCVAAGFDRDVARRVEHLIYI
FT                   SEYKRYQAAPGARLTPRAFWLDRRYPIVNRWRDPS"
     atggccgacc gtttccgtat cactctggcg cagctcaacc ccaccgtggg cgatctggcg        60
     ggcaatgccg ccaaggcgcg catggcctgg gagcatggcc gcgaggcggg ggccgatctg       120
     gtggctctgc ccgaaatgtt cgtgaccggc tacaacacgc aagacctggt gttgaaaccg       180
     gtgtttcacg atgccgcgat tgcgatgatc gaggcgctgg ccgaggaatg tgccgacggc       240
     ccggcgctgg ccatcggcgg ccccttggtc gaggaaggca agctgtacaa cgcttacctg       300
     atcctcaagg gcggcaagat cgtcagccgc tcgctcaaga cccatttgcc caacgagacg       360
     gtgttcgacg aggtgcgcat tttcgatgcc gggccgctgg gcggtcccta ttcggtaggc       420
     aatacccgca tcggcagccc gatctgcgag gatgcctggc acgaggatgt ggccgagacc       480
     ctggccgaga ccggggccga gttcttgctg gtgcccaatg gctcgcccta ttaccgcgac       540
     aaatacgaca tgcgcatcaa ccagatggtg gcgcgggtgg tcgaaaccgg cctgccgctc       600
     atttatctca atatggtggg tggtcaggac gatcaggtgt tcgatggtgg cacattcggt       660
     ctgaacccgg gcggcgcgct ggcgttccgc atgccggtct ttgacgaggc gatcacccat       720
     gtcgatctgg aacgcgggtc cgagggctgg cagatcgtcc agggagaggt ggcgccgctg       780
     cccgatgcct gggagcagga ttaccgcgtg atggtcgaaa gcctgcgcga ctacatgcgc       840
     aagaccggct ttgccaaggt gctgctgggc ctgtccggcg gggtggattc ggcgctggtg       900
     gcggcgattg ccaccgatgc gctggggcct gagaacgtgc gctgtgtgat gctgccctcg       960
     gaatacacca gccggtcatc gctggacgat gccgaggccg tggcgcaggc gctgggcgtg      1020
     cgctatgact atgtgccgat ctcggaaagc cgggcggcgg tgaccaatac gctggcgccg      1080
     ctgtttgccg ggaccgagcc gggcctgacc gaggagaaca tccagtcccg cctgcgcggc      1140
     ctcttgctga tggcgctgtc caacaagttc ggagagatgc tgctgaccac cggcaacaag      1200
     tccgaggtgg cggtgggcta tgccacgatc tatggcgaca tggcgggtgg ttataacccg      1260
     atcaaggatc tctacaagac gcgggtgttc gagacctgcc gctggcgcaa cgccaatcac      1320
     cggctctgga tgatgggacc ggcgggcgag gtgatccggc cttcggtcat cgacaagccg      1380
     cccagtgccg aactgcgcga ggatcagaag gacagcgaca gcctgccgga ttatcccgag      1440
     ctggacgcga tcctggatat tctggtcgat caggacggct ccatcgccga ttgcgtggcc      1500
     gccgggttcg accgcgatgt cgcccgccgg gtcgagcatc tgatctatat cagcgagtac      1560
     aagcggtatc aggcggcccc cggtgcgcgg ctgaccccac gtgccttctg gctggaccgg      1620
     cgttatccca tcgtgaatcg ctggcgcgac ccgagttga                             1659
//

If you have problems or comments...

PBIL Back to PBIL home page