(data stored in ACNUC7421 zone)

EMBL: CP000031.NUSA

CP000031.NUSA        Location/Qualifiers
FT   CDS_pept        complement(66012..67637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="SPO0063"
FT                   /product="transcription termination factor NusA"
FT                   /note="identified by match to protein family HMM PF00013;
FT                   match to protein family HMM TIGR01953; match to protein
FT                   family HMM TIGR01954"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93394"
FT                   /db_xref="GOA:Q5LWL2"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWL2"
FT                   /protein_id="AAV93394.1"
FT                   /translation="MAITSANQLELLQTAEAVAREKMIDPGLVIEAMEESLARAAKSRY
FT                   GAEMDIRVSIDRKTGKATFTRVRTVVADEELENYQAEFTVDQAKQYMENPQIGDTFVEE
FT                   VPPVEMGRIAAQSAKQVILQKVREAERDRQYEEFKDRAGTIINGLVKREEYGNVIVDVG
FT                   AGEAILRRNEKIGRESYRPNDRIRCYIKDVRREPRGPQIFLSRTAPEFMAELFKMEVPE
FT                   IYDGIIEIKAVARDPGSRAKIAVISYDNSIDPVGACVGMRGSRVQAVVNELQGEKIDII
FT                   PWNEDQPTFLVNALQPAEVSKVVLDEEAGKIEVVVPEEQLSLAIGRRGQNVRLASQLTG
FT                   LDIDIMTEAEESARRQKEFESRTNLFMETLDLDEFFAQLLVSEGFTNLEEVAYVELDEL
FT                   LVIDGVDEGTAEELQARARDYLEAQAKAALDNARALGAEDSLIQFEGLTPQMVEALAKD
FT                   DVKTLEDFATCADWELAGGWTTVDGQRVKDDGILEPFGVSLEDAQDMVMTARVMLGWVD
FT                   PTELLEEAEETEEGETATDEEAGA"
     atggcaatca cctctgcaaa ccagcttgag ctgctgcaaa ccgccgaggc cgtggcccgt        60
     gagaagatga tcgaccccgg gttggtgatc gaagcgatgg aggaatccct cgcccgcgcg       120
     gccaagagcc gctacggcgc cgagatggat atccgcgtca gcatcgaccg caagaccggc       180
     aaggcgacct ttacccgcgt ccgtaccgtc gtcgccgatg aagagctgga gaattatcag       240
     gccgagttca ccgtcgacca ggccaagcag tacatggaaa acccgcagat cggcgatacc       300
     ttcgtcgaag aggtgccccc ggtcgagatg ggccgcatcg ccgcgcaatc cgccaagcag       360
     gtgatcctgc aaaaggtgcg cgaagccgaa cgtgaccgcc agtacgaaga gttcaaggac       420
     cgcgccggca ccatcatcaa cggcctcgtc aagcgcgagg aatacggtaa cgtcatcgtc       480
     gatgtgggcg cgggcgaagc gatcctgcgt cgcaacgaga agatcggccg cgaaagctat       540
     cgccccaacg accgtatccg ctgctacatc aaggatgtgc gccgcgagcc gcgcgggccg       600
     cagatcttcc tgtcgcgcac cgcgccggaa ttcatggccg agctgttcaa gatggaagtg       660
     ccggaaatct atgacggcat catcgagatc aaggccgtgg cccgcgaccc gggcagccgc       720
     gccaagatcg ccgtgatctc ctatgacaac tcgatcgacc cggtcggcgc ctgcgtcggt       780
     atgcgcggca gccgtgtgca ggccgtggtg aacgagcttc agggcgaaaa gatcgacatc       840
     atcccgtgga acgaggatca gccgaccttc ctggtgaacg cgctgcaacc ggccgaagtg       900
     tccaaggttg tgctggacga agaagccggc aagatcgagg tcgtggtgcc cgaggaacag       960
     ctgagcctgg ccatcggccg tcgcggccag aacgtgcgcc tggccagcca gctgaccggt      1020
     ctggacatcg acatcatgac cgaggccgag gaatcggcgc gccgtcagaa ggaattcgag      1080
     agccgcacca acctgttcat ggagaccctg gatctggacg aattctttgc ccagctgctg      1140
     gtctccgaag ggttcaccaa tctcgaagag gtcgcctatg tcgagcttga cgaactgctg      1200
     gtgatcgacg gggtcgacga gggcaccgcc gaagagctgc aggcccgtgc ccgcgattat      1260
     ctcgaggcac aggccaaggc ggcgctggac aatgcccgcg cgctgggcgc cgaggacagc      1320
     ctgatccagt tcgagggcct gacgccccag atggtcgagg cgctggccaa ggacgacgtc      1380
     aagacgctgg aagatttcgc aacctgcgcc gactgggaac tggccggtgg ctggaccacg      1440
     gtcgacggtc agcgggtcaa ggatgacggc attctggagc ccttcggcgt ttcgctggaa      1500
     gatgcgcagg acatggtgat gaccgcccgc gttatgctgg gctgggtcga tccgaccgaa      1560
     ctgctcgaag aggcggaaga gaccgaagaa ggcgaaaccg caaccgacga ggaggccgga      1620
     gcctga                                                                 1626
//

If you have problems or comments...

PBIL Back to PBIL home page