(data stored in ACNUC7421 zone)

EMBL: CP000031.OHR

CP000031.OHR         Location/Qualifiers
FT   CDS_pept        complement(273966..274406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ohr"
FT                   /locus_tag="SPO0254"
FT                   /product="organic hydroperoxide resistance protein"
FT                   /note="identified by similarity to GB:AAC38562.1; match to
FT                   protein family HMM PF02566"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93574"
FT                   /db_xref="GOA:Q5LX35"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX35"
FT                   /protein_id="AAV93574.1"
FT                   /translation="MEPQMTVSPVYTAHARATGGRNGQAQVAESGLDLVLATPPAMGGN
FT                   GKGHNPEQLFAAGYAACYIGAMQFATTQDKTLAKVPADISVDAEVGIGPRAEGGFGLTV
FT                   ALKVSMPGVDAAEAQRIADAGHAICPYSNATRGNIVVTTEIA"
     atggagcccc aaatgaccgt ttcccccgtc tataccgccc atgcccgcgc caccggcggc        60
     cgcaatggcc aggcccaggt cgccgaatcc ggccttgacc tggtgcttgc caccccgccc       120
     gcgatgggtg gcaatggcaa gggccataac cccgaacagc tgttcgccgc cggctatgcc       180
     gcctgctata tcggtgcgat gcaattcgcc acgacccagg acaagacgct ggccaaggtg       240
     cccgccgata tctcggtcga tgccgaggtc ggcatcggtc cccgcgccga gggcgggttc       300
     ggcctgaccg tggcgctcaa ggtctcgatg cccggcgtcg atgccgccga ggcgcagcgc       360
     atcgcagatg cgggccacgc catctgcccc tattccaacg ccacccgtgg caacattgtc       420
     gtcacgaccg agatcgcatg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page