(data stored in ACNUC7421 zone)

EMBL: CP000031.PANB

CP000031.PANB        Location/Qualifiers
FT   CDS_pept        104880..105719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="SPO0102"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="identified by match to protein family HMM PF02548;
FT                   match to protein family HMM TIGR00222"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93433"
FT                   /db_xref="GOA:Q5LWP5"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWP5"
FT                   /protein_id="AAV93433.1"
FT                   /translation="MSATARKTAPNAQDIRARKGGVPLVSLTAYTTPMARLMDGHCDFV
FT                   LVGDSVGMVLHGLNSTLGVTMEMMILHGQAVARGLDRAMLVIDMPFASYEEGPAQAFRN
FT                   AARLMAETGAGAVKLEGGVEMAETIRFLVKRGIPVMAHIGLTPQSINTLGGYKVQGRDD
FT                   QAQAVLADARAVADAGAFSVVLEKVPATLADRITAEVAIPTIGIGASAGCDGQILVVDD
FT                   MLGFFTAFKPKFVKRYADLGPLAEAAIAEYAAEVRARSFPAAEHVFGDQAPAKGAKA"
     atgagtgcga ctgcccgcaa gactgccccc aatgcgcagg atatccgcgc gcgcaagggc        60
     ggggtgccgc tggtcagcct gaccgcctat accacgccga tggcgcggct gatggatggg       120
     cattgcgatt tcgtgctggt gggcgacagc gtcggcatgg tgctgcacgg gctgaattcc       180
     accctgggtg tgacgatgga gatgatgatc ctgcacggtc aggcggtggc gcgcgggctg       240
     gaccgcgcga tgctggtgat cgacatgcca ttcgccagct acgaggaggg tccggcgcag       300
     gcgttccgca atgccgcccg gctgatggcc gagaccggcg ctggtgcggt caagctggaa       360
     ggcggggtcg agatggccga gaccatccgc tttctggtca agcgcggcat tccggtgatg       420
     gcccatatcg ggctgacgcc gcagtcgatc aacacgctgg gcggatacaa ggtgcagggc       480
     cgcgacgatc aggcccaggc ggtgctggcc gatgcccgcg cggtggccga tgcgggcgct       540
     ttttcggtcg tgctcgagaa ggtgcctgcg acgctggccg accggatcac tgccgaggtt       600
     gcgattccga ccattggcat cggggcctct gccgggtgcg acgggcagat cctggtggtt       660
     gatgacatgc tgggcttttt caccgcgttc aaaccgaaat tcgtcaaacg gtacgccgat       720
     ctgggtccgc tggccgaggc ggcgattgcc gaatacgccg ccgaagtgcg cgcgcgcagc       780
     tttccggcgg cggaacatgt gtttggcgat caggccccgg ccaaaggtgc caaggcatga       840
//

If you have problems or comments...

PBIL Back to PBIL home page