(data stored in ACNUC9435 zone)

EMBL: CP000031.PANC

CP000031.PANC        Location/Qualifiers
FT   CDS_pept        105716..106573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="SPO0103"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="identified by similarity to SP:P31663; match to
FT                   protein family HMM PF02569; match to protein family HMM
FT                   TIGR00018; match to protein family HMM TIGR00125"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93434"
FT                   /db_xref="GOA:Q5LWR2"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWR2"
FT                   /protein_id="AAV93434.1"
FT                   /translation="MSAPILRKLADLRAATAGWKRAGESIGVVPTMGALHDGHLSLVAA
FT                   AKAGCDRVVVTIFVNPKQFNNPEDLAKYPRTELADASKLAPYGVDAIYVPDPDQIYPEG
FT                   FATTVSVSGLTDVMEGACRPGHFDGVATVVAKLFLQTGADQAYFGEKDYQQMMLVTRMA
FT                   QDLDIPITVVGCPTVREASGLAMSSRNMRLSAEGLERAGRLHPVMRQVAERLAAGASFG
FT                   DLAPGAREALGAAGFVDIEYFDLRAADSLRALDRPTEPARLLVAAWLDGVRLIDNIAVS
FT                   QLND"
     atgagcgcgc cgatcctgcg caagctggcc gatctgcgcg ccgccaccgc cggctggaag        60
     cgcgcgggcg agagcatcgg cgtggtgccc acgatgggcg cgctgcatga cgggcacctg       120
     tcgctggtcg cggcggccaa ggcgggctgc gaccgagtgg tggtgaccat tttcgtcaac       180
     ccgaaacagt tcaacaaccc cgaagatctg gccaagtatc cccgcaccga actggccgac       240
     gcgtccaagc tggcgcccta tggggtcgat gcgatctatg tgcccgatcc tgaccagatc       300
     tatcccgagg ggtttgcgac caccgtttcg gtctcgggcc tgaccgacgt gatggagggc       360
     gcgtgccgcc ctggtcattt cgacggcgtg gcaaccgtgg tggccaaact gttcctgcaa       420
     accggggccg atcaggccta tttcggcgaa aaggactatc agcagatgat gctggtgacc       480
     cgcatggcgc aggatctgga tatcccgatc accgtggtgg ggtgccccac ggtgcgcgag       540
     gcctcgggcc ttgcgatgtc gtcgcgcaac atgcggctgt cggctgaggg gctggagcgg       600
     gccggtcggc tgcatcccgt catgcggcag gtggccgagc ggctggcggc tggcgcctct       660
     tttggtgatc tggcgcccgg ggcgcgcgag gcgctgggcg ccgccggttt tgtcgatatc       720
     gagtacttcg atctgcgcgc ggcggacagc ctgcgcgcac tcgaccgtcc caccgaaccc       780
     gcgcgcctgt tggtggcggc ctggctcgac ggggttcggc tgatcgacaa tatcgcggtt       840
     tcccaactaa acgattag                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page