(data stored in ACNUC7421 zone)

EMBL: CP000031.PARA

CP000031.PARA        Location/Qualifiers
FT   CDS_pept        2473..3276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="SPO0003"
FT                   /product="chromosome partitioning protein ParA"
FT                   /note="identified by similarity to SP:O05189; match to
FT                   protein family HMM PF01656"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93334"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWF1"
FT                   /protein_id="AAV93334.1"
FT                   /translation="MSDLSRPAGPRIIAVANQKGGVGKTTTAINLAAALVESGQRVLVV
FT                   DLDPQGNASTGLGVDERELTTYELLVDDAPLNSVIQKTSIDGLSIVPATVDLSSADIEL
FT                   ISNEKRSFLLHDALRQTAMDAYSWDYILIDCPPSLNLLTVNAMVAAHSVLVPLQSEFFA
FT                   LEGLSQLMLTIREVRQAANPNLRIEGIVLTMYDRRNNLSQQVEKDARDNLGDLVFETKI
FT                   PRNVRVSEAPSFAMPVLNYDPNSLGAMAYRDLAAELMKKHNKIAA"
     gtgtctgatc tttcccgtcc tgccggaccc cggatcattg cggtcgccaa ccagaagggc        60
     ggcgtgggaa agaccacaac tgccatcaac ctcgccgcag cattggtgga atccggccag       120
     cgtgtgctgg ttgtggatct tgacccgcaa gggaatgcct cgaccgggtt gggtgtggat       180
     gaacgagaat tgacgaccta tgaactgttg gttgatgacg cgccgttgaa ttcggtgatc       240
     cagaaaacca gcatcgacgg cctgtcgatc gtgccggcca cggtcgatct gagttcggcg       300
     gatatcgagc tgatttcgaa tgaaaagcgc agtttcctgc tgcatgacgc cctgcggcag       360
     acggcgatgg atgcctattc ttgggactat atcctgatcg actgcccgcc ctcgctgaac       420
     ctgttgacgg tcaacgccat ggttgccgcg cattcagttc ttgtgccgtt gcaaagcgag       480
     ttctttgcgc tcgaaggcct gtcccagctg atgctgacca tccgcgaggt gcgacaggca       540
     gcaaacccca atctgcggat cgaggggatt gtattgacca tgtatgaccg acgcaacaac       600
     ctgtcgcagc aggtcgagaa ggacgcgcgc gacaatctgg gtgatctggt attcgaaacc       660
     aagatccccc gcaatgtgcg ggtcagcgag gcaccgtctt ttgccatgcc ggtgctcaac       720
     tacgatccga actctctggg tgcgatggcc tatcgtgacc tggccgcgga actgatgaag       780
     aaacataaca agatcgccgc ctga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page