(data stored in ACNUC9435 zone)

EMBL: CP000031.PARB

CP000031.PARB        Location/Qualifiers
FT   CDS_pept        3299..4189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="SPO0004"
FT                   /product="chromosome partitioning protein parB"
FT                   /note="identified by similarity to SP:O05190; match to
FT                   protein family HMM PF02195; match to protein family HMM
FT                   TIGR00180"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93335"
FT                   /db_xref="GOA:Q5LWG0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWG0"
FT                   /protein_id="AAV93335.1"
FT                   /translation="MVSNKPRGLGRGLSALMADVTQPAEAAASEAARRPDRTVPIEKLR
FT                   ANPNQPRRTFTEDALQELAASIKEKGVLQPLIVRPVDGDMYEIVAGERRWRAAQLAQLH
FT                   QVPVLVRELDDTEVLEIAIIENIQRADLNAVEEAAGYRQLMDKFGHTQEKLAEALGKSR
FT                   SHIANLLRLLSLPDDVQTLVVEGKLSAGHARALITSDNPSELAKIVVRDGLSVRATEAL
FT                   VKKQAEGDKPTATARPKSITADKDADTRALEKDLSAILAMKVAINHKPGTETGQVVLTY
FT                   ENLDQLDDLCAKLSR"
     atggtttcga acaagccccg gggattggga cgcggattgt ccgcgttgat ggccgatgtg        60
     acgcagccgg ccgaggccgc cgctagcgag gcagcgcgtc gtccggaccg caccgttccg       120
     atcgagaaac tgcgtgccaa ccccaaccag cctcgccgca cctttaccga ggacgcgttg       180
     caagagcttg ccgcttcgat caaggaaaag ggggttctgc agcccttgat cgtgcgtccc       240
     gttgatggcg atatgtacga gatcgttgcg ggagaacgtc gctggcgcgc ggcgcagctg       300
     gcgcaactgc atcaggtgcc tgttttggtc cgcgagctcg acgataccga agtcctggaa       360
     atcgcgatca tcgagaacat tcagcgcgct gatctgaacg cggtggaaga ggcggcgggc       420
     tatcgccagc tgatggacaa gtttggccac acccaggaaa agctggccga agctctgggc       480
     aaaagccgaa gccatatcgc aaacttgctg cgacttctgt cgttgcctga cgacgttcag       540
     acacttgttg tcgaggggaa attgtccgcg ggccatgcgc gcgccctcat caccagcgac       600
     aacccgtcag aactggccaa gatcgtcgtg cgggacgggc tgtcggtgcg cgcgaccgaa       660
     gcgctggtca agaagcaggc cgaaggggac aagccgaccg cgacggcgcg tccgaaatcc       720
     atcactgcgg acaaagacgc cgatacccgg gcgctggaaa aggatctgtc ggccattctg       780
     gcgatgaagg tagcgatcaa tcacaagccg ggaacggaaa ccgggcaggt ggtgctgacc       840
     tatgagaacc tcgatcagct tgatgatctt tgtgcaaaac tcagccgtta g                891
//

If you have problems or comments...

PBIL Back to PBIL home page