(data stored in ACNUC7421 zone)

EMBL: CP000031.PE100

CP000031.PE100       Location/Qualifiers
FT   CDS_pept        complement(102166..103113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0100"
FT                   /product="peptide/opine/nickel uptake family ABC
FT                   transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93431"
FT                   /db_xref="GOA:Q5LWP7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWP7"
FT                   /protein_id="AAV93431.1"
FT                   /translation="MLRYSLKRALSLAISLAVASLVIFAVIEIAPGDPASFMLGVNAQP
FT                   DTLAALRTELGLDQSKAERYVSWVTGMLRGDFGTSYTYRTPVSQMIADRLWVSLPLALY
FT                   ALALSTAIALPAGIYAAARRGKPGDLAVMGATQLGVAVPNFWFAMMLVLIFAINLRWFN
FT                   AGGFAGWDKGLTAGLHSLTLPAIALALPQAAILARVMRSALLDILGEDFMRTARAKGLT
FT                   RRQALWRHGLRNALIPVLTIIGLQFSFLLAGSIIIEQVFYLPGLGRLVFQAISARDLIV
FT                   VESVVMLLVFAVIVVNFLVDLAYALVDPRLRTRT"
     atgctccgtt acagcctgaa acgcgcgctc tcgcttgcga tcagcctggc cgtcgccagc        60
     ctggtcatct ttgcggtgat cgagatcgct ccgggggatc cggcctcgtt catgctgggg       120
     gtcaatgcgc agcccgatac gctggccgcg ctgcgcaccg agctgggtct ggatcagtca       180
     aaggccgaac gttatgtcag ctgggtcacc ggcatgctgc gtggcgattt tggcacctct       240
     tacacctatc gcaccccggt ttcgcagatg atcgcggacc ggctctgggt ctcgctgccg       300
     ctcgcgctct acgcgctggc actgtccacc gccatcgccc tgcccgccgg catttatgcc       360
     gcagcccgcc ggggcaaacc cggcgatctg gccgtgatgg gcgcgaccca gctgggcgtc       420
     gcggtgccca acttctggtt cgccatgatg ctggttctga tctttgccat caacctgcgc       480
     tggttcaatg ccggcggttt tgccggctgg gacaaggggc tgaccgccgg tctgcattcg       540
     ctgaccctgc ccgccatcgc tctggccctg ccgcaggcgg cgatcctggc gcgggtgatg       600
     cgttcggccc tgctcgacat cctgggtgag gatttcatgc gcaccgcgcg ggccaagggg       660
     ctcacccgcc gtcaggcgct gtggcggcat gggttgcgca atgcactgat cccggtgctg       720
     accatcatcg gcctgcaatt ctcgttcctg ctggcgggat cgatcatcat cgagcaggtg       780
     ttctatctgc ccggcctcgg gcggctggta ttccaggcga tctcggcacg cgacctgatc       840
     gtggtggaat cggtcgtcat gctgctggtc tttgcggtga tcgtggtcaa tttcctggtc       900
     gatctggcct atgctctcgt cgatccgcgc ctgaggacgc ggacatga                    948
//

If you have problems or comments...

PBIL Back to PBIL home page