(data stored in ACNUC7421 zone)

EMBL: CP000031.PE101

CP000031.PE101       Location/Qualifiers
FT   CDS_pept        complement(103222..104709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0101"
FT                   /product="peptide/opine/nickel uptake family ABC
FT                   transporter, periplasmic substrate-binding protein"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93432"
FT                   /db_xref="GOA:Q5LWP6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWP6"
FT                   /protein_id="AAV93432.1"
FT                   /translation="MKRFVKQGVVSGLALSAALFAGAAWAKDDITIAMQLEPPHLDPTS
FT                   AAAQAIDSVVYVNIFEGLTRFMGDGSIVPALAESWEISGDGTVYTFRLHAGVTFHDGSA
FT                   MDAEDVKFSLDRARAEDSANAQKALFAGIDSVDVVDPLTVKVTLKEPNGNFLFNMAWGD
FT                   AVIVAPESIENIKTAPVGTGPYTLGEWVQGDKIVLNRNTGYWGDQPALAQATFKFISDP
FT                   TAAFAAMMAEDVDVFTGFPAPENLPQFEADPRFQVLVGSTEGETILSTNNKQAPFDNVK
FT                   VRQAMAHAIDRQAIIDGAMFGYGTPIGTHFAPHNPAYVDLTGTSAHDPDKAKALLAEAG
FT                   LPNGFETTLHLPPPSYARRGGEIIAAQLAEVGIKAEIINVEWAQWLETVFKGKDFGLTI
FT                   VSHTEPMDIGIYARPEYYFQYDNATFQELMGTLNSTTDPDKRTELMQQAQRIISEDYVN
FT                   GYLFQLAALSVAKAGVQGLWVNAPTAANDLSAISWSE"
     atgaaacggt ttgtaaaaca aggggttgtc tctggccttg cgctaagcgc cgcgctcttc        60
     gccggggccg cctgggccaa ggatgacatt accatcgcga tgcagctgga gccgccgcat       120
     ctggacccga ccagcgccgc cgcgcaggcc atcgactcgg tggtctatgt caacatcttc       180
     gaggggctga cccgcttcat gggcgatggc tcgatcgtgc ctgccctggc cgaaagctgg       240
     gaaatctcgg gcgatggcac cgtctatacc ttcaggctgc acgcgggcgt gaccttccat       300
     gacggctcgg ccatggatgc cgaggacgtc aagttcagcc tggatcgcgc ccgcgccgaa       360
     gacagcgcca acgcgcaaaa ggcactgttc gccgggatcg acagcgtcga tgtggtcgat       420
     ccgctgaccg tcaaggtgac cctgaaagag cccaacggca atttcctgtt caacatggcc       480
     tggggtgacg cggtgatcgt ggcgcccgag agcatcgaga acatcaagac cgcgccggtg       540
     ggcaccggcc cctacacgct gggcgaatgg gtgcaaggcg acaagatcgt gctgaaccgc       600
     aacaccggtt actggggtga ccagccagcg ctcgcgcaag cgacgttcaa gttcatctcg       660
     gaccccacag ccgccttcgc cgcaatgatg gccgaggatg tggacgtgtt caccggcttc       720
     cccgcgcccg agaacctgcc gcaattcgag gcggacccgc ggttccaggt gctggtcggg       780
     tcgaccgagg gggaaacgat cctgtcgacc aacaacaagc aggcgccctt tgacaacgtc       840
     aaggtacgcc aggcgatggc gcatgccatc gaccgtcagg ccatcatcga tggcgccatg       900
     ttcggatacg gcacgccgat cggcacccat ttcgcaccgc acaacccggc ttatgtcgat       960
     ctgaccggca cctctgccca tgatcccgac aaggccaagg cactgctggc cgaggccggg      1020
     ttgccgaacg ggttcgagac cacgctgcac ctgccgcccc cctcttatgc gcggcgcggc      1080
     ggcgagatca tcgcggccca gttggccgag gtcggcatca aggccgagat catcaatgtc      1140
     gaatgggcgc agtggctgga aaccgtgttc aagggcaagg atttcgggct gaccatcgtc      1200
     agccataccg agccgatgga tatcggcatc tacgcccgtc ccgaatatta cttccagtat      1260
     gacaacgcga ccttccagga gctgatgggc acgctgaact ccaccaccga cccggacaag      1320
     cgaaccgagc tgatgcaaca ggcgcagcgg atcatctccg aagattacgt gaacggttac      1380
     ctgttccagc tggcggcgct gagcgtggcc aaggccggcg tgcagggcct gtgggtcaac      1440
     gcccccacgg ccgccaacga cctttcggcg atcagctggt ccgaatag                   1488
//

If you have problems or comments...

PBIL Back to PBIL home page