(data stored in ACNUC9435 zone)

EMBL: CP000031.PE106

CP000031.PE106       Location/Qualifiers
FT   CDS_pept        complement(109440..110210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0106"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to SP:Q9A321; match to
FT                   protein family HMM PF03883"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93437"
FT                   /db_xref="GOA:Q5LWQ9"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWQ9"
FT                   /protein_id="AAV93437.1"
FT                   /translation="MLVVISPAKRLDWAERDVATTEPAFQDDAVRLAKTARNLTLGDLK
FT                   KLMGLSDDLARLNRDRFREFADAPGADVTRPAALAFAGDTYQGLEAASLDSEEMDWAQQ
FT                   HLRILSGLYGVLRPLDAIQAYRLEMGSRLKTRRGTSLYDYWGDQLSRTLNAQADEIGTD
FT                   VLVNCASQEYFGAVDPKALKLRVITPVFMEDKGGAPKIVSFFAKKARGAMARYIVQRRL
FT                   TDPQALSEFDSGGYQYNADLSAPDKPVFLRPYQG"
     atgctggtgg tgatctctcc ggccaagcgg ctggattggg cagagcgcga cgtcgcgacg        60
     accgagcccg cctttcagga cgatgcggtg cggctggcca agaccgcgcg caacctgacg       120
     ctcggcgatc tcaagaaact gatggggctg agcgacgatc tggcccggct caaccgcgac       180
     cggttccgcg aattcgccga tgcgccgggc gcggatgtga cccgccctgc cgcgctggcc       240
     tttgccggtg acacctatca ggggctcgag gcggcctcgc tcgactccga ggaaatggac       300
     tgggcgcagc agcacctgcg catcctgtcg gggctttacg gcgtgttgcg tccgctggat       360
     gcgatccagg cctatcgtct ggaaatgggc agccggttga agacccggcg agggacctct       420
     ctctatgact attggggtga ccagctgtcc cggacgctga acgctcaggc cgatgaaatc       480
     ggcacggatg tgctggtcaa ctgcgctagc caggaatact ttggcgccgt cgaccccaag       540
     gcgctgaaac tgcgggtgat cacgcccgtg ttcatggagg acaagggcgg cgcgcccaag       600
     atcgtcagct ttttcgccaa gaaggcgcgc ggggcgatgg cccgttacat cgtgcaacgc       660
     cgtctgaccg atccacaggc gctgagcgag ttcgacagcg gcggatacca gtacaacgct       720
     gacctgtccg cacccgacaa gccagtgttc ctgcgcccct atcaaggctg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page