(data stored in ACNUC7421 zone)

EMBL: CP000031.PE111

CP000031.PE111       Location/Qualifiers
FT   CDS_pept        complement(116991..118055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0111"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:H82993"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93441"
FT                   /db_xref="GOA:Q5LWQ4"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWQ4"
FT                   /protein_id="AAV93441.1"
FT                   /translation="MCLRGTAAKLSSGSLGDLAGTEMRRRPMQWKRYGTVAVILSVLLG
FT                   GAYVFWLDSQTAELPAGIVRSNGRIEAERIDVATKLPGRIAEVRVSEGQWVEAGSLVAH
FT                   MDTAEIDAQLRQAKAAVAQAEQQKLQTEALLNQRLSEQEFAQAEFARAEQLAARGHAPQ
FT                   ELVDQRKSALTTADAGVAAARAGIDLATATIASADATVERLQSIRADADLVAPHDGRVQ
FT                   YILAKAGEVVGAGGRVVTLTDLTDIYMTIFLPARDAGLLAIGSEARIVLDPIPEYVIPA
FT                   TVTFVASTAQFTPKSVETADERDQLMFRVKLTIPEDLLKAYQEQAKAGVAGVGYVRTDD
FT                   TAPWPDVLSVKLPQ"
     atgtgtttac gcggcactgc agcgaaacta agttcaggaa gccttggtga tttagcgggc        60
     accgagatga ggagaagacc aatgcaatgg aaacgctatg gcacagttgc tgtcatcctc       120
     agcgtgcttt tgggcggcgc atacgtattc tggttggaca gccaaaccgc agagctcccg       180
     gctggcatcg tcaggtcgaa cgggcggatc gaggcagagc gtatcgatgt ggcgactaag       240
     cttccggggc gtatcgccga ggtgcgcgtt tccgagggcc agtgggtcga ggcaggaagc       300
     ctggtggcgc atatggatac tgccgagatc gacgcccagt tgcgccaagc caaggccgcc       360
     gtcgcccagg cagagcagca gaaactgcaa accgaggccc tgctgaacca acgcctgtcc       420
     gaacaggaat tcgcgcaggc ggaatttgcc cgcgccgagc aacttgccgc aagggggcac       480
     gcgccacagg aactggtcga tcaaagaaaa tccgccctga caaccgcaga tgccggagtg       540
     gccgccgccc gagcaggcat cgatcttgca actgctacga tcgcctcggc agacgcaaca       600
     gttgaacgac tgcaaagcat ccgggccgat gcagatctgg tggctccgca cgatgggcga       660
     gttcaataca tcctcgccaa ggcaggagaa gttgtcggcg ccggtggcag ggtcgtgacg       720
     ctgaccgatc tgaccgacat ctacatgacg atctttcttc ccgcgcgcga cgccggtctg       780
     ctggccatcg gttccgaggc gcggattgtc ctggatccga tcccagaata cgtgatcccg       840
     gcaaccgtca cgtttgtcgc cagcacagcc caattcaccc cgaaatcggt cgagacggcg       900
     gatgagcgcg atcagttgat gtttcgcgtc aagctgacaa tccccgagga cctgctgaag       960
     gcatatcagg aacaggccaa agcgggtgtt gccggagtgg gctatgtccg caccgacgac      1020
     actgccccct ggcccgacgt gctgtcggtg aagctgccgc aatga                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page