(data stored in ACNUC7421 zone)

EMBL: CP000031.PE115

CP000031.PE115       Location/Qualifiers
FT   CDS_pept        121130..122524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0115"
FT                   /product="maoC family protein/phosphate acetyl/butaryl
FT                   transferase"
FT                   /note="identified by match to protein family HMM PF01515;
FT                   match to protein family HMM PF01575"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93445"
FT                   /db_xref="GOA:Q5LWR7"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWR7"
FT                   /protein_id="AAV93445.1"
FT                   /translation="MQYIENKTFDEIRIGDSAELTRKLKADDIELFAVMSGDVNPAHVD
FT                   EEYARSDMFHEVVAHGMWGGALISAVLGTELPGPGTIYLNQNLSFRRPVGLGDTVTVRV
FT                   TVASKDAGTKRLKLDCLCVNQDGETVIKGQAEVIAPSEKVRRPRVVLPDVHLHERGARY
FT                   RDLIAATHAMAPVRTAIVHPCDALSLTGALEAASQGLIVPILVAPRVKLEAVAEEAGLV
FT                   LDGVEIVDVPHSHAAAERAVALVRCGKAEALMKGKLHTDELMDPVVDRDTGLRSERRMS
FT                   HIFALDVPHYPKPLFVTDAAINIFPDLDTKRDIVQNAIDLAQALGIDRPKVAILSAVET
FT                   VYPKIPSTIEAAALCKMWDRGQITGGVLDGPLAFDNAVSKSAAKAKGIVSEVAGDADIL
FT                   VVPDLEAGNMIAKQLIHLAGAEAAGIVLGARVPIILTSRADGVMSRLASSAMAQLYIHH
FT                   AKKVVS"
     atgcagtaca tcgaaaacaa gacgttcgac gaaatcagga ttggcgacag tgccgaactg        60
     acccgcaagc taaaggccga tgacatcgag cttttcgcgg tgatgtcggg cgatgtgaac       120
     ccggcccatg tcgatgagga atacgccagg tcggacatgt ttcacgaagt cgtcgcacac       180
     ggcatgtggg gcggcgcgct gatttcggcg gttctgggca ccgaacttcc cggccccggc       240
     acgatctacc tcaaccagaa cctcagcttt cgccgccccg tggggttggg cgataccgtg       300
     acggttcgcg tgaccgtggc ctcgaaggat gccgggacca agcggctgaa gcttgactgc       360
     ctttgcgtca atcaggacgg agagaccgtt atcaaagggc aggccgaggt catcgcgccg       420
     tccgagaagg tccgtcgccc ccgcgtggtc ctgcccgacg tgcatctgca cgaacggggc       480
     gcgcgctatc gcgacctgat cgcggcgaca catgcgatgg cgccggtgcg caccgccatt       540
     gtccatccct gcgacgctct gtcactgacc ggcgcgctgg aggcggcaag ccaggggctg       600
     atcgtcccga tcctcgtcgc acccagggtg aaactcgaag ccgtggccga agaggccggc       660
     cttgtccttg acggtgtcga gatcgtggat gtcccgcaca gccacgcggc cgccgaacgg       720
     gctgtcgcgc tggtccgctg cggcaaggcc gaagcgttga tgaaaggcaa gttgcacacc       780
     gacgaattga tggatccggt ggttgaccgc gacacgggcc tgcgcagcga acgccggatg       840
     agtcatattt tcgctctcga cgtgccgcac tatcccaagc ctcttttcgt gaccgacgcg       900
     gcgatcaaca tctttcccga cctcgatacc aagcgagaca tcgtgcaaaa cgccatcgat       960
     ctggcgcagg cgctggggat cgaccggcca aaggtcgcga tcctttctgc ggtggaaacg      1020
     gtctatccca agatcccgtc cactatcgag gccgctgcac tgtgcaagat gtgggaccgt      1080
     ggccagatca ccggcggcgt gctcgacggc cccttggcct tcgacaacgc cgtgtcgaag      1140
     tcagcggcaa aggccaaggg catcgtctcg gaagtggcgg gcgatgccga tatcctcgtc      1200
     gtgcctgatc tcgaggcggg caacatgatc gccaagcaac tgatccatct tgcgggtgcc      1260
     gaggctgcag ggattgtcct cggcgctcgc gtaccgatca ttctgaccag ccgggcggat      1320
     ggcgtgatgt cgcggctcgc atcatcggca atggcacagc tttacatcca ccacgcgaaa      1380
     aaggtcgtgt catga                                                       1395
//

If you have problems or comments...

PBIL Back to PBIL home page