(data stored in ACNUC7421 zone)

EMBL: CP000031.PE118

CP000031.PE118       Location/Qualifiers
FT   CDS_pept        complement(127691..128194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0119"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93448"
FT                   /db_xref="GOA:Q5LWR4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWR4"
FT                   /protein_id="AAV93448.1"
FT                   /translation="MYVAQSNSRKKEKEPSNLRSKESVLDSIDAAILRELCADARIPRA
FT                   ELSRRVGLSAPSVGDRVRRLEDIGIITGYGARIDPARLGYGLTILIRARPLPGEMANMI
FT                   EAIQDTPQIVACDRVSGEDCFVARAHVRDVAEMEAVIDRIVPFGATNSSIVQSSPVEER
FT                   LVEL"
     atgtatgtgg cgcaatcaaa ctcccgaaag aaggaaaaag aaccctcaaa ccttcgatcc        60
     aaagaaagcg ttctcgacag catcgatgcg gcgattctgc gcgaactctg tgctgacgcc       120
     cgtattccac gcgcggaact gtcccgccgc gtcggcctct ctgccccgag tgtgggagac       180
     cgtgtgcggc gtctcgaaga tatcggtatc atcaccggat acggggcgcg catcgacccc       240
     gcgcgtctcg gctatggttt gacgatcttg atccgtgccc gccctttgcc gggtgaaatg       300
     gcaaatatga tcgaagccat tcaggacacg cctcaaattg tcgcttgcga ccgtgtgtca       360
     ggtgaagact gcttcgtcgc gcgtgcgcac gtccgtgacg tcgcggaaat ggaagcggtc       420
     atcgaccgga tcgtgccctt cggcgcgacg aactcttcaa tcgtgcaatc gtcacctgta       480
     gaagagcgat tggttgaact ctga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page