(data stored in ACNUC7421 zone)

EMBL: CP000031.PE120

CP000031.PE120       Location/Qualifiers
FT   CDS_pept        complement(130161..130448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0122"
FT                   /product="YGGT family protein"
FT                   /note="identified by match to protein family HMM PF02325"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93450"
FT                   /db_xref="GOA:Q5LWS8"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWS8"
FT                   /protein_id="AAV93450.1"
FT                   /translation="MQSLFQILMLILDVIWFFILAHVIMSWLINFQVLNMRQQLVAQIW
FT                   YGLNRVLEPIYGPIRRILPPMGGLDLTPLVVLLAIMALRIVLINNAALFY"
     atgcagtcgc tgtttcaaat cctgatgctg atcctggatg tgatctggtt cttcatcctg        60
     gcccatgtga tcatgagctg gctgatcaac tttcaggtcc tgaacatgcg ccagcagctg       120
     gtggcgcaga tctggtacgg gctgaaccgg gtgctggagc cgatctatgg cccaatccgc       180
     cggatattgc cgccgatggg cgggctcgac ctgaccccgc tggtggtgct gctggcgatc       240
     atggcgctgc gcatcgtgct gatcaacaac gcggcactgt tctattga                    288
//

If you have problems or comments...

PBIL Back to PBIL home page