(data stored in ACNUC7421 zone)

EMBL: CP000031.PE121

CP000031.PE121       Location/Qualifiers
FT   CDS_pept        130602..131966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0123"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93451"
FT                   /db_xref="GOA:Q5LWS7"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWS7"
FT                   /protein_id="AAV93451.1"
FT                   /translation="MADISARKRIWGWYFFDWASQPYHTLLVTFVFSPFFAAVAADYFL
FT                   GQGMADEAAKAQAQVVWSQCLTITGLIIGFGAPFLGAMADISGRRMTWITLFCGMYVVG
FT                   AWGLWYMDPTGGNLWWMMASFGIGFIGAEYALIFINAQLPSLGTKEEVGQISGSGFAFG
FT                   YLGGVVALFIMLLLFVEQGNGKTLVGLDPVLGLDPDTREGTRAVGPFTALWFVIFMIPY
FT                   FLWVREPAGSGRRGSFAEAVAMVVQSVKNLRHRGSLASYLASSMFYRDALNGLYGFGGV
FT                   YARLVLGWEITMIGVFGIIAAISAAAFSWLGGLADRRVGPKPVIVGSILVLILVCATIV
FT                   GMDRTQIFGIPLAEGSGLPDFVFFFCGVLIGGFGGIVQAASRSLMVRHTDPEMPTESFG
FT                   LYGLSGRATAFLAPALIGAATAATGSARLGVSPVVGLFILGLILLIWVKPQGDQK"
     atggcggata tctcggcgcg caagcgtatc tggggctggt atttcttcga ctgggccagc        60
     caaccctatc acaccctgct tgtgaccttt gtgttcagcc cgttctttgc cgcggtggcg       120
     gcggattact tcctgggtca ggggatggcg gacgaggccg ccaaggcgca ggcccaggtg       180
     gtctggtcgc aatgtctgac catcaccggg ctgatcatcg gtttcggcgc accctttctg       240
     ggggcaatgg ccgatatctc gggccggcgc atgacctgga tcacgctgtt ctgcggcatg       300
     tatgtcgtcg gtgcctgggg cctgtggtac atggatccga ctggtggcaa cctgtggtgg       360
     atgatggcca gtttcggcat cggtttcatc ggtgcagaat atgcgctgat cttcatcaat       420
     gcacagctcc cctcgctagg caccaaggag gaggtgggcc agatctcggg atcggggttt       480
     gcctttgggt atctcggcgg ggtggtggcg ctgttcatca tgctgctgct ctttgtcgag       540
     cagggcaatg gcaagacgct ggtcgggctc gacccggtat tgggtcttga tccggatacc       600
     cgcgagggga cacgcgccgt tggcccgttc accgcgctct ggttcgtgat cttcatgatc       660
     ccctatttcc tgtgggtgcg cgaacccgcc ggcagcggac ggcgcggcag ttttgccgaa       720
     gcggttgcga tggtggtgca atcggtcaag aacctgcgcc accgaggcag cctggccagc       780
     tatctggcgt cgtcgatgtt ttatcgcgat gcgctcaacg ggctttacgg ctttggcggg       840
     gtctatgccc ggctggtgct gggctgggag atcacgatga tcggcgtgtt cggcatcatc       900
     gcggcgatct cggcggcggc gttcagctgg ctgggcgggc tggcggatcg cagggtgggg       960
     ccaaaaccgg tcatcgtcgg ctcgatcctg gtgctgatcc tggtctgcgc caccattgtg      1020
     ggcatggacc ggacccagat attcggcatc ccgctggccg agggctcggg cctgcccgat      1080
     ttcgtcttct tcttctgcgg cgtgttgatc ggcgggttcg gcggtatcgt gcaggcggcc      1140
     agccggtcgt tgatggtgcg ccataccgat cccgaaatgc ccaccgaaag ctttggtctt      1200
     tacggcctgt ccggccgggc caccgccttt ctggcgcctg ccctgatcgg cgccgcgaca      1260
     gcggcgacag gctcggcgcg cttgggggtt tcgccggtcg tcggcttgtt tattctgggc      1320
     ttgatcctgt tgatttgggt gaaaccgcaa ggggaccaga aatag                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page