(data stored in ACNUC7421 zone)

EMBL: CP000031.PE124

CP000031.PE124       Location/Qualifiers
FT   CDS_pept        133714..134445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0126"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF02592;
FT                   match to protein family HMM TIGR00697"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93454"
FT                   /db_xref="GOA:Q5LWS4"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWS4"
FT                   /protein_id="AAV93454.1"
FT                   /translation="MLRAKRPACPRSRRTKSPHPCQNGPRNMTRAFLPGILAMAAIVVA
FT                   SNILVQFLILDGLLTWGAFTYPLAFLVTDVMNRVYGAEAARRVVFAGFVTGVICSLIGS
FT                   QIVLQGDGYTYAAVPLRIAVASGSAFLIAQLTDVAVFNRFRGGRWWRAPLVSTLIGSAL
FT                   DTALFFTIAFSASITLFGPDADTAVNWAWEAVPFMNKGAPMPLWVTLAFADWLVKLSLA
FT                   LIALVPFRVIVQRLAPARATA"
     gtgttgcggg ctaaacgccc ggcttgtccg cgctcaaggc ggaccaagtc gccgcaccct        60
     tgtcaaaacg gaccccgaaa catgacccgc gcattccttc ccggcattct cgccatggcc       120
     gccatcgtgg tggcgtcgaa catcctcgtc cagttcctga tcctcgacgg attgctgacc       180
     tggggcgcct tcacctatcc gctggccttt ctggtcaccg atgtgatgaa ccgggtctat       240
     ggggccgagg ccgcgcggcg cgtggtgttt gccggttttg tgaccggggt gatctgttcg       300
     ctgatcggca gccagatcgt gctgcagggc gatggctata cctatgctgc cgtgccgctg       360
     cgcatcgcgg tcgcctcggg ctccgcgttc ctgatcgcgc aactgaccga tgtggcggtg       420
     ttcaaccggt tccggggcgg gcgctggtgg cgggcgccgc tggtgtcgac cctgatcggc       480
     tcggcgctgg acaccgcact gttctttacc atcgcctttt cggccagcat caccctgttt       540
     ggacccgatg ccgacaccgc cgtcaactgg gcgtgggagg cggtgccctt catgaacaag       600
     ggcgcgccga tgccgctgtg ggtgacgctg gcctttgccg actggctggt caagctgtcg       660
     ctggcgctga tcgcgctggt cccgttccgc gttatcgttc aacggcttgc accggcccgc       720
     gcgaccgcct ga                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page