(data stored in ACNUC7421 zone)

EMBL: CP000031.PE125

CP000031.PE125       Location/Qualifiers
FT   CDS_pept        134704..135123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0127"
FT                   /product="peptidyl-tRNA hydrolase domain protein"
FT                   /note="identified by similarity to GB:AAM35138.1; match to
FT                   protein family HMM PF00472"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93455"
FT                   /db_xref="GOA:Q5LWS3"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWS3"
FT                   /protein_id="AAV93455.1"
FT                   /translation="MLYVTDDIAIQDWELSESFMRASGPGGQNVNKVSSAVELRFEAAR
FT                   SPSLPAPVKARLKRLAGRRWTGEGAIVLQCDETRSQARNREIVRARLVELIARALVAPK
FT                   RRIATKPTRGSVRRRLDSKKARGEVKALRGKIGDE"
     atgctgtatg tgaccgacga tatcgcgatc caggattggg agctgagcga aagcttcatg        60
     cgcgcctcgg ggccgggcgg gcagaatgtg aacaaggtgt cctcggccgt cgaattgcgg       120
     ttcgaggcgg cgcgctcgcc ctccttgccc gctccggtca aggcgcggct gaaacggctg       180
     gccgggcggc gctggaccgg cgagggggcc atcgtcctgc aatgtgacga gacccgcagc       240
     caggcccgca accgcgagat cgtgcgcgcc cgcctggtcg agctgatcgc ccgtgcgctg       300
     gtcgccccga aacgccgcat cgcgaccaag cccacgcgcg gttcggtgcg gcgccgtctc       360
     gactccaaaa aggcgcgcgg cgaggtcaag gccctgcgtg ggaagatcgg cgacgaatag       420
//

If you have problems or comments...

PBIL Back to PBIL home page