(data stored in ACNUC9435 zone)

EMBL: CP000031.PE127

CP000031.PE127       Location/Qualifiers
FT   CDS_pept        135951..136958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0129"
FT                   /product="peptidase, T4 family"
FT                   /note="identified by match to protein family HMM PF03576"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93457"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWS1"
FT                   /protein_id="AAV93457.1"
FT                   /translation="MVPGPRNLITDVPGLLVGNAQDDALKSGATVLSAEAPFMASVHVM
FT                   GGAPGTRETDLLAPDKSVARIDALVLSGGSAYGLDACSGVSDALRAAGRGYRIADAVIP
FT                   IVPGAIIFDLLNGGDKDWADNPYRALGRAAFDAAGRDFALGTTGAGTGALTAMLKGGLG
FT                   SASLVLPDGTTVGALVAANPMGSVTTPGDRHFWAAPFEIDGEFGGLGPDPSGGLGRQLE
FT                   SRKIRMMSAQAQDRANTTIAIVATDADLTKAQCQRMAVAAHDGIARATVPAHSPGDGDL
FT                   VFSVSTGARPMAAPERDLTLLGHAAALCLARAIARAIYLARPAPGDLLPCWHQA"
     atggttcccg gcccccgcaa cctgatcacc gatgtgcccg gcctgttggt cggcaatgcg        60
     caggacgatg cgttgaaatc cggcgccacc gtgctgagcg ccgaggcgcc cttcatggcc       120
     tcggtgcatg tgatgggcgg ggcacccggc acgcgcgaga ccgatctgct ggcgcctgac       180
     aaatcggtgg cgcggatcga tgcgctggtg ctgtcgggcg ggtctgccta tgggctggat       240
     gcctgttcgg gcgtctccga tgcgctgcgg gccgctgggc gcggctatcg catcgccgat       300
     gcggtcattc ccattgtacc tggcgccatc atttttgacc tgctcaatgg cggggacaag       360
     gactgggccg acaaccctta tcgcgcgctg ggccgtgccg cgttcgatgc ggcgggcagg       420
     gatttcgcgc tgggcaccac cggggcgggc accggggcgc tgaccgcgat gctcaagggt       480
     gggcttggtt cggcctcgct ggtgctgccc gacggaacca cggtgggcgc gctggttgcc       540
     gccaatccga tgggcagtgt caccaccccc ggagatcgcc atttctgggc tgccccgttc       600
     gagatcgacg gcgagttcgg cgggctgggt cccgacccca gcggcgggtt gggccggcag       660
     cttgaaagcc gcaagatacg gatgatgtcc gcccaggcgc aggaccgcgc caataccacc       720
     atcgccatcg ttgccaccga tgccgacctg accaaggcgc aatgccagcg gatggcggtg       780
     gccgcccatg acggcatcgc ccgcgccacg gttccggccc attcgccggg cgatggcgat       840
     ctggttttct cggtttcgac cggcgcccgc ccgatggccg cgcccgagcg tgacctgacc       900
     ttgctgggtc acgctgccgc gctgtgcctg gcccgcgcca ttgcccgcgc catctatctg       960
     gcgcgcccgg cgcccggtga tctgctgccc tgctggcatc aggcgtga                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page