(data stored in ACNUC7421 zone)

EMBL: CP000031.PE128

CP000031.PE128       Location/Qualifiers
FT   CDS_pept        137081..137494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0130"
FT                   /product="cytochrome c family protein"
FT                   /note="identified by match to protein family HMM PF00034"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93458"
FT                   /db_xref="GOA:Q5LWT7"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWT7"
FT                   /protein_id="AAV93458.1"
FT                   /translation="MNRFVAAAFACVLAVPALAEGDAAKGEKGFNKCKSCHMIESPAGE
FT                   TIVKGGKTGPNLYGVVGRAAGTYEGYKYGDSLVAAGEKGLVWDEESFVAFTQDPKSFLN
FT                   TYLGETAAKSKMTFKLKSGGEDVFAYLQSVAAE"
     atgaaccgat ttgtcgccgc cgcctttgcc tgcgttcttg ccgttcccgc cctcgccgag        60
     ggtgacgccg ccaagggtga gaagggtttc aacaagtgca agtcctgcca catgatcgag       120
     agccccgcgg gcgagaccat cgtcaagggc ggcaagaccg ggccgaacct gtatggcgtc       180
     gtgggccggg ccgccggcac ctatgaaggg tacaaatacg gtgacagcct ggttgctgcc       240
     ggcgaaaagg gtctggtctg ggacgaagag agctttgtcg ccttcaccca ggaccccaaa       300
     agcttcctga acacctatct gggtgaaacg gcggccaagt cgaaaatgac cttcaagctt       360
     aaatcgggtg gcgaggacgt gttcgcctat ctgcaaagcg tcgccgccga ataa             414
//

If you have problems or comments...

PBIL Back to PBIL home page