(data stored in ACNUC9435 zone)

EMBL: CP000031.PE129

CP000031.PE129       Location/Qualifiers
FT   CDS_pept        137668..138210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0131"
FT                   /product="isopentyl-diphosphate delta-isomerase"
FT                   /EC_number="5.3.3.2"
FT                   /note="identified by similarity to SP:P26173; match to
FT                   protein family HMM PF00293; match to protein family HMM
FT                   TIGR02150"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93459"
FT                   /db_xref="GOA:Q5LWT6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR011876"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWT6"
FT                   /protein_id="AAV93459.1"
FT                   /translation="MGILIPAWVDDRLVPVDKLEAHEKGLKHKAVSVFAVRDMDILIQR
FT                   RALGKYHTPGLWANTCCTHPDWDESASTCAVRRLREELGITGLYPEYRHRLEYHADVGN
FT                   GMVENEVVDVFLAHVRGPLQVVPNPDEVMEIRWIGYHDLLAEVQRYPERFTPWLKIYLH
FT                   HHADTIFGPDLIISAKA"
     atgggcatcc tgattccggc ttgggtcgac gataggcttg ttccggtgga caagctcgaa        60
     gcgcatgaga agggtctgaa acacaaggcg gtttcggtct ttgcggtgcg tgacatggac       120
     atcctgatcc agcgccgggc gctgggcaaa taccacacgc ccggcctgtg ggcgaatacc       180
     tgctgcaccc atcccgactg ggacgagagc gcctcgacct gtgcggtgcg gcgcctgcgc       240
     gaggagctgg ggatcaccgg gctttatccc gagtaccggc accggcttga gtaccacgcg       300
     gacgttggca atggcatggt cgaaaacgag gtggtggatg tcttcctcgc ccatgtgcgt       360
     ggcccgttgc aggtggtgcc caatcccgac gaggtgatgg agatccgctg gatcggctat       420
     cacgacctgc tcgccgaggt gcagcgctat cccgagcggt tcacgccctg gctcaagatt       480
     tatctgcacc accatgccga caccatcttt ggccccgatc tgatcatctc ggccaaggcc       540
     tga                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page