(data stored in ACNUC9435 zone)

EMBL: CP000031.PE131

CP000031.PE131       Location/Qualifiers
FT   CDS_pept        140575..146001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0133"
FT                   /product="PAN domain protein"
FT                   /note="identified by match to protein family HMM PF00024;
FT                   match to protein family HMM PF01835; match to protein
FT                   family HMM PF07703"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93461"
FT                   /db_xref="GOA:Q5LWT4"
FT                   /db_xref="InterPro:IPR000177"
FT                   /db_xref="InterPro:IPR001599"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR003609"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR011625"
FT                   /db_xref="InterPro:IPR021868"
FT                   /db_xref="InterPro:IPR026284"
FT                   /db_xref="InterPro:IPR041203"
FT                   /db_xref="InterPro:IPR041246"
FT                   /db_xref="InterPro:IPR041462"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWT4"
FT                   /protein_id="AAV93461.1"
FT                   /translation="MRRFGFLAILSLQLAFFGVSGLSAQEAAPGFRYLATRDMDFYGED
FT                   LDALFDTDLQSCIRACSANNACNAFTFNARSNACFPKRGVSEQTPYQGALSAVKLPSPA
FT                   AVRDRARQQAARLAFLPDRDLTRAVAQARDLGLRYAAGGMELDQVIAAMRNAGEGAQAA
FT                   GWAGLAVSLSDRADLWAEYARLLLSVRSDDSSIKRDHARRAVSAAINAYLRADRPGAEV
FT                   SALALLAQALERDGRGRDMVPVLRLASDIQPREDVLAALDRAIGKYGFRVVETTVESDS
FT                   AQPRICAQFSDPLARSGVDYEPFVHSPEGDLVVQADGNQLCLDGVEHGKRYRITLRAGL
FT                   PAGSGEALWKDVTLTHYVRDRSPAVRFPGRSYVLPKSADAAIPVETVNATTLDLILRRV
FT                   SDRNLLRAVQEGYFARPLSYWEDEHFASDIAQEVWTGSAEVASTLNRDMTTRLPLAEAI
FT                   SGQAAGIYTLTARVPGADPYDNPGATQWFVLSDLGLSSISGNDGLHVSVRGLSDAAPRA
FT                   AVDLTLISRANAVLGRVQTDAQGLARFEPGLTRGTGAAAPALILATAGDTDLGFLSLID
FT                   PAFDLSDRGVEGRKPAGPVDVFLTTDRGAYRAGETIHATALSRDGTARAIDGLPLTAIL
FT                   TRPDGVEYGRKVSDGGVAGGHVFALTTGASAPRGTWRLDIKADPDGPALASQTLLVEDF
FT                   LPERIDFDLALPDAPILPGDSPPLSIEARYLFGAPGADLSIEGQVQLRAADQIAGWPGY
FT                   RFGRHDAGLQTRTSHFGDARTDAAGNARLAVEIPQIDAEGKPLEAVVTARLADGAARPV
FT                   ERRISVPVSPATPVIGIKPLFEDVVSEGTEAGFQVIGLTPDLTPQPMRIKWTLNRVETR
FT                   YQWYQLYGNWNWEPVTRRTRIATGEADLGSDPLSLSQPVEWGEYELLVERLDGAYVASS
FT                   ADFYAGWYQAADAAATPDRLELSLDKDSYRPGDTARLRIVPRMAGTALVTVLSDRVIAR
FT                   QAVEVAAGESVIPLTVTEDWGTGAYVTATVIRPMDVAAGQNPARALGLAHATIEPVGKA
FT                   LTVAIDAPEVAKPRATQPVRLTVAGAQAGDEVWLTLAAVDLGILNLTGFQSPDPQGHYF
FT                   GQRRLGVEMRDVYGRLIDGMNGAMGIVRSGGDADNGLRMQSPPPTQDLMAVFSGPVQVG
FT                   ADGGVSVDVPLPAFNGTVRLMAVAWSDQAVGQAERDMIVRDPVVVTATVPRFLAPGDSS
FT                   RLRLEVVHADGPPGEMALKLASAPGLQLGAAPDRFTLTEGGKAVFEVPVTATALGDPVL
FT                   TVELETPGGQELRQVLRLPVRANDPVVAQTRRFALGAGDSFLFSRDVFTGLRPGSARAI
FT                   LSAGPLARFDAPGLLGVLDRYPYGCTEQVTSQAMPLLYLGAVAQAAGLGTGPQVAERID
FT                   AAIRRILTRQSANGAFGLWRAESGDFWLDAYASDFLSRARAEGYALPDRAFAMAMDNLR
FT                   NRLNYAPDFDEGGEDIAYALMVLAREGAAAMGDLRYYADVKADAFTTPLGAAQLGSALA
FT                   MYGDQTRADAMFARAARMVAGQRPEAPVWRADYGTSLRDAAGLLTLAAEAGSAVIDRDS
FT                   LISRISQPAGEMSTQEAAWSLLAAQALVKQPEQSGLRVNGAAVDGPFVQVLAGTSDEVL
FT                   NITAVDGGATDITLTMLGVPEVPLPAGGTGYTITRARYTMDGAPIQRDAFAIGERFVTV
FT                   LTVTPFEASGGRLMVNDPLPAGFEIDNPSLLRSGDVRALDWLSLDEASHTEFRSDRFLA
FT                   AVDLYGTRPVTLAYVTRAVSPGAFHHPAASVEDMYRPRYRARTDTGRIRVGQ"
     atgcgacgtt ttggatttct tgcaattctt tctcttcagt tggctttttt cggggtgtcg        60
     ggcctctcgg cacaagaggc cgcgcccggt tttcgctatc tcgccacccg cgacatggat       120
     ttttatggcg aggatctgga cgcgctgttc gataccgatc tgcaatcctg catccgggcc       180
     tgctcggcaa acaacgcttg taacgctttc accttcaacg cgcgctcgaa cgcctgtttc       240
     cccaaacgcg gcgtcagcga gcagacgcct tatcaggggg cgctgtcggc ggtgaaactg       300
     cccagcccgg cggcggtgcg tgaccgggcg cgtcaacaag cggcgcggct ggctttcctc       360
     ccggaccgcg acctgacccg cgctgtcgcg caggcgcgcg atctgggact gcgctatgcc       420
     gccggcggga tggagttgga tcaggtcatc gctgcgatgc gcaacgcggg cgagggggcg       480
     caggccgccg gatgggccgg gctggcggtg tcgctgtcgg atcgtgccga tctgtgggcc       540
     gaatacgccc gcctgctgct gagtgttcgc agcgatgaca gcagcattaa acgcgaccat       600
     gcgcgccggg cggtttcggc tgcgatcaac gcctatttgc gggcggatcg tcccggcgcc       660
     gaagtttcgg cgctggccct gctggcgcag gcactggaac gggacgggcg cggccgtgac       720
     atggtgccgg tgctgcggct ggccagtgac atccagccgc gcgaggacgt gctggcggcg       780
     ctggataggg caattggcaa atacgggttc cgcgtggtcg agaccacggt cgaaagcgac       840
     agcgcccagc cgcgcatctg cgcccagttc tcggacccgt tggcgcgcag cggtgtcgat       900
     tacgagccct tcgttcactc gcccgagggg gatctggtcg tgcaggccga tggcaaccag       960
     ctgtgtcttg acggtgtcga acatggcaaa cgctatcgca tcaccctgcg tgcggggctg      1020
     ccggctggat ccggtgaggc gctctggaag gacgtgacgc tgacccatta cgtgcgagac      1080
     cgcagcccgg cggtgcgttt cccgggtcgg tcctatgtgc tgccgaaatc ggcggatgcg      1140
     gcgataccgg tcgagacggt gaacgccacc acgcttgatc tgatcttgcg gcgggtcagc      1200
     gaccgcaacc tgctgcgcgc ggtgcaggag gggtatttcg cgcgcccgct gtcctattgg      1260
     gaagacgagc atttcgcttc cgatatcgcg caagaggtct ggaccggcag tgccgaagtg      1320
     gccagcacgc tcaaccgcga catgaccacc cgcttgccat tggcagaggc gatctcgggc      1380
     caggcggccg gtatctatac gctgacggcg cgggtgccgg gggctgaccc ctatgacaat      1440
     cccggtgcca cccaatggtt cgtgctgtcc gatctgggcc tgtcctcgat ctcaggcaat      1500
     gacgggctgc atgtttctgt gcgcggtctt tccgacgcgg cgccccgcgc agcggttgac      1560
     ctgacgctga tctcgcgtgc caatgcggtg ctgggccggg tccagaccga tgcacagggg      1620
     ctggcgcggt tcgaaccggg gctgacgcgg ggcacgggcg cggcggcgcc agcgttgatc      1680
     ctggcaacgg cgggcgacac cgatctgggg ttcctgtcgc tgatcgaccc ggcctttgac      1740
     ctgtccgacc ggggcgtcga ggggcgcaag cccgcgggcc ccgtcgatgt gttcctgacc      1800
     accgaccggg gcgcctatcg tgcgggcgag accattcatg ccacagccct cagccgcgat      1860
     ggcaccgcgc gcgccatcga cggcctgcca ctgaccgcga tcctgacccg gcccgacggg      1920
     gtggaatatg gccgcaaggt ctcggatggt ggcgttgcag gggggcatgt ctttgcgctg      1980
     accaccggtg ccagcgcccc gcgcggcact tggcggttgg atatcaaggc cgatcccgac      2040
     gggccagcgc tggccagcca gaccctgctg gtcgaggatt tcctgcccga gcggatcgat      2100
     tttgacctgg cgctgcccga tgcgccgatc ctgcccggcg acagcccgcc gctgagcatc      2160
     gaggcgcgct atctgttcgg ggcgccgggc gccgatctga gcatcgaggg acaggtgcaa      2220
     ttgcgcgccg ccgaccagat cgcgggctgg cccggatacc ggtttggccg ccatgacgcc      2280
     gggcttcaga cccgcaccag ccatttcggc gatgcccgca ccgatgcggc gggcaatgcc      2340
     cggctggcgg tcgagatccc gcagatcgac gccgagggca aaccgctcga ggcagtggtg      2400
     acggcgcggc tggccgatgg cgccgcccgc ccggtcgaac gccggatctc ggtgccggtc      2460
     tcgccggcca cccccgttat cggcatcaag ccgctgttcg aggatgtggt gagcgagggt      2520
     accgaggctg gattccaggt gatcggcctg accccggacc tgacgcccca gcccatgcgg      2580
     atcaaatgga cgctgaaccg ggtcgagacg cggtatcagt ggtaccagct ttacggcaac      2640
     tggaactggg agccggtgac ccgccgcacc cgcatcgcta ccggcgaggc cgatctgggc      2700
     agcgatccgc tgtccctgtc gcagccggtg gaatggggtg aatacgaact cctcgtcgag      2760
     cggctggatg gggcctatgt cgcctcctct gccgatttct atgccggctg gtatcaggcc      2820
     gccgatgcgg cggcgacgcc cgatcggctg gagctttcgc tggacaagga cagctatcgc      2880
     ccgggcgaca ccgcgcggct gcggatcgtg ccgcgcatgg cgggcaccgc gctggtcacg      2940
     gtgctgtcgg accgggtgat cgcgcggcag gcggtcgagg tggcagcggg cgaaagcgtg      3000
     atcccactta cggtgaccga ggattggggc accggcgcct atgtcaccgc aacggtgatc      3060
     cggccgatgg acgtggccgc cgggcagaac ccggcgcgtg cactgggtct ggcccatgca      3120
     acgatagaac cggtgggcaa ggcgctgacg gttgcgatcg acgcgcccga ggtggccaaa      3180
     ccgcgcgcca cccagcccgt gcgcctgacg gttgcgggcg cgcaggcggg tgacgaggtc      3240
     tggctgacgc tggcggcagt cgatctgggc atcctgaacc tcaccggctt ccagagtccc      3300
     gatccgcagg gtcactattt tggccagcgg cggctggggg tcgagatgcg cgatgtctat      3360
     ggccggttga tcgacggcat gaacggcgcc atggggatcg tgcgctcggg cggggatgcc      3420
     gataatggcc tgcggatgca atcgccgccg ccgacccagg acctgatggc ggtgttcagt      3480
     ggcccggtgc aggtgggtgc cgatggcggc gtttcggtcg atgtgccctt gcccgccttc      3540
     aacggcactg tgcgtctgat ggcggtggcc tggtcagacc aagcggtcgg acaggccgag      3600
     cgggacatga tcgtgcgcga tccggtggtg gtgacggcga cggtgccgcg cttccttgcg      3660
     cccggcgaca gcagccggtt gcggctggag gtggtgcatg ccgatggccc gccgggcgag      3720
     atggcgctga aactggccag tgccccgggc ctgcaattgg gcgccgcgcc cgaccggttc      3780
     accttgaccg agggtggcaa ggccgtgttc gaggtgccgg tcaccgccac cgcgctgggc      3840
     gatccagtgt tgacggtcga attggagacg ccgggcgggc aagagctgcg ccaggtgcta      3900
     aggctgccgg tgcgcgccaa tgatccggtg gtggcccaga cccggcgctt tgcgttgggg      3960
     gcaggcgaca gtttcctgtt ctcgcgcgat gtcttcaccg ggctcaggcc cggatcggcc      4020
     cgcgccatcc tgtcggccgg gccgctggcg cggtttgatg cgccgggcct gttgggggtg      4080
     ctcgaccggt atccctatgg ctgcaccgaa caggtgacct cgcaggcgat gccgctgctt      4140
     taccttggtg cggtggcaca ggcggcgggg ctgggcaccg ggccgcaggt ggccgagcgg      4200
     atcgacgccg cgatccggcg catcctgacc cggcaaagcg ccaatggcgc ctttggcctg      4260
     tggcgtgccg agagcggtga tttctggctc gacgcctatg cctcggactt tctcagccgg      4320
     gcccgggccg aaggctatgc cctaccggac cgcgcctttg ccatggcgat ggacaacctg      4380
     cgcaatcggt tgaactatgc ccccgatttc gacgaagggg gcgaggatat cgcttatgcc      4440
     ctgatggtgc tggcgcgcga gggcgcggcg gcgatgggcg atctgcgcta ttacgccgac      4500
     gtcaaggcgg atgcctttac cacgccgctg ggcgcggcac agctggggtc ggcgctggcc      4560
     atgtatggcg accagacgcg ggccgacgcg atgtttgccc gcgccgcgcg catggtcgcg      4620
     gggcagcggc ctgaggcacc cgtctggcgg gccgattacg gtaccagcct gcgcgatgcg      4680
     gcgggcctgt tgacgctggc cgccgaggcg ggcagtgcgg tgatcgaccg ggattccctg      4740
     atcagccgca tcagccagcc tgcgggtgag atgtcgaccc aggaagcggc ctggagcctg      4800
     cttgcggcgc aggccctggt gaaacagccc gaacaatcgg gcctgcgggt gaatggcgcg      4860
     gcggtggatg ggccctttgt gcaggtgctt gcagggacca gcgacgaggt gctcaacatc      4920
     accgccgtcg atggtggcgc caccgatatc accctgacca tgctgggtgt acccgaggtt      4980
     ccgctgcccg ccggtggtac cggctacacc atcacccgcg cccgctacac gatggacggg      5040
     gcgcccatcc agcgcgacgc tttcgccatt ggcgaacggt tcgtgacggt gctgaccgtg      5100
     accccgttcg aggcctcggg cgggcggctg atggtgaacg atccgctgcc cgcagggttc      5160
     gagatcgata acccctcgct gttgcgttcg ggcgatgtgc gggcgctgga ctggctgtcg      5220
     ctggacgagg ccagccatac cgagttccgc agcgaccgct tcctggcggc ggtcgatctg      5280
     tacggcaccc ggcccgtcac gctggcctat gtcacccgcg cggtgagccc gggcgcgttc      5340
     caccacccgg cggcctcggt cgaggacatg taccgccccc gctatcgtgc ccgcaccgac      5400
     acgggccgca tccgtgtcgg gcaatga                                          5427
//

If you have problems or comments...

PBIL Back to PBIL home page