(data stored in ACNUC7421 zone)

EMBL: CP000031.PE132

CP000031.PE132       Location/Qualifiers
FT   CDS_pept        145998..146564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0134"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAB50328.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93462"
FT                   /db_xref="GOA:Q5LWT3"
FT                   /db_xref="InterPro:IPR009467"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWT3"
FT                   /protein_id="AAV93462.1"
FT                   /translation="MSGREAVATAHWRRLDGEGSDRCTLSRVAQGWIMVGHAHWRDEGC
FT                   DTTLSYDIRCAPDWRSLSADVAGERGGRPLSMRIEATPMGWRMDDVLQPGTEDCSDLDL
FT                   SFTPATNLMPIRRLGAFAGDELRVAAAWLMPDLDCVARLDQIYTRLPDGRVHYASAGFA
FT                   ADLDLHGSGFTTLYPGLWQGWVDDA"
     atgagcgggc gcgaggcggt ggccaccgcc cattggcggc ggctggatgg cgaaggctcc        60
     gaccgctgca ccctttcgcg ggtggcgcag ggctggatca tggtgggcca cgcccattgg       120
     cgcgacgagg gctgtgatac cacgctcagc tatgacatcc gctgcgcacc cgactggcgc       180
     agcctgtcgg cggatgtggc cggagagcgt ggtggtcgcc ccctgtcgat gcggatcgag       240
     gcgacgccga tgggctggcg gatggacgac gtgctgcaac cgggcaccga ggattgcagc       300
     gatctggacc tcagctttac cccggcgacc aacctgatgc cgatacggcg gctgggggcc       360
     tttgcgggcg acgagttgcg cgttgccgcc gcctggctta tgcccgacct ggattgcgtg       420
     gcgcggctgg atcagatcta tacccggttg ccggatggtc gggtgcatta tgcctcggcc       480
     gggtttgcgg cggatctcga cctgcatggc agcggtttta ccacccttta tcccgggctc       540
     tggcagggtt gggtcgatga tgcctag                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page