(data stored in ACNUC7421 zone)

EMBL: CP000031.PE134

CP000031.PE134       Location/Qualifiers
FT   CDS_pept        complement(148600..150645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0136"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC47727.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93464"
FT                   /db_xref="GOA:Q5LWT1"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWT1"
FT                   /protein_id="AAV93464.1"
FT                   /translation="MTGDLLLDPLVPLPLLIALAALSLAGIALALWRGLSGWALRGLAA
FT                   LVLLAALAGPVWQVEDRAPLSDIVLMVEDQSASQGLSDRPDQTTSAADQLAASIESRPN
FT                   TELRRIIVGDGEGDTGTQLMAALNEALNEEPRARIAGILALSDGQVHDLDRAPALPAPM
FT                   HLLLSGRATDWDRRLIVRNAPAFAIIGEPVTLSLRIEDSGAVPAGQGALAELQISVDGG
FT                   PPERLTLPVGQDLELPVTLPHGGRNVVQFSVPVAEGELTDRNNTALIQMNGVRDRLRVL
FT                   LVSGQPHPGGRTWRNLLKSDSSVDLVHFTILRPPEKQDGVPVDELSLIAFPTRELFLEK
FT                   IDDFDLIIFDRYKRRGILPAIYLDNVANYVNRGGAVLVAAGPDFATADSIYRTPLSPVL
FT                   PARPTARVIEEAYRAQVTEEGARHPVTAQLDSAGEWGRWLRQIEVTQDSGHVLMSGVEG
FT                   RPLLVLDRVGEGRVALLATDHAWLWGRGYEGGGPQLELLRRLAHWMMKEPELEEDALWA
FT                   EAQGQTMRIIRRTLDTSVGSVTITRPDGGEDVLPMEEVSPGRFEALYQGPEIGLYRLRE
FT                   GDQSAVIGLGPAAPREFEATIATAALMEPLITPLKSGIFRLEDGLPTIRNVREGRPAAG
FT                   RGWLGLTPRGAYETRDVRQTPLAPAWLVLLLASGFVIAGWLREGRR"
     atgaccggag acctcctgct cgatccgctt gttccgctgc cgctgctgat cgcgctggcc        60
     gccctgtcgc tggccggtat cgcattggcg ctgtggcggg gtctgtcggg ctgggccctg       120
     cgcgggctgg cggcgctggt gctgctggcc gcgctcgccg gtccggtctg gcaggtcgaa       180
     gaccgcgcgc ccctttccga catcgtgctg atggtcgaag atcagagcgc cagccagggc       240
     ctgtccgacc gaccggacca gaccacaagc gccgccgacc aactggccgc cagcatcgag       300
     agccgcccca ataccgagct gcgccgcatc attgtcggcg atggcgaggg cgataccggc       360
     acccagctga tggcggcgct gaacgaggcg ctgaacgaag agccgcgcgc ccggatcgcg       420
     ggtatcctcg ccctgtcgga cggtcaggtg cacgatctgg accgcgcgcc cgccctgccg       480
     gcgccgatgc atctgctgct ttcgggccgg gcgaccgact gggaccgccg cctgatcgtg       540
     cgcaacgccc ccgcctttgc catcatcggc gagccggtga ccctgagcct caggatcgag       600
     gattccggcg cggtgcccgc cgggcagggg gcgctggccg agttgcagat ctcggtcgat       660
     ggcggcccgc ccgagcggct gaccctgccg gtcggccaag acctggaact gccggtcacc       720
     ctgccccatg gcgggcgcaa cgtggtgcag ttctcggtcc ccgtggccga gggcgagctg       780
     accgaccgca acaacaccgc gctgatccag atgaacggcg tgcgcgaccg tctgcgggtg       840
     ctgctggttt cgggtcagcc gcatccgggc ggacgcacct ggcgtaacct gctcaaatcg       900
     gacagttcgg tcgatctggt acatttcacc atcctgcgcc cgcccgagaa acaggacggc       960
     gtgccagtgg atgaactgag cctgatcgcc tttcccaccc gcgagctgtt tctggaaaag      1020
     atcgacgatt tcgacctgat catctttgac cgctacaagc ggcgcggcat cctgccggcg      1080
     atctatctgg acaatgtcgc caattacgtg aaccggggcg gcgccgttct ggtggcggcg      1140
     gggccggatt tcgccaccgc cgacagcatc taccgcacgc ccttgtcgcc ggtcctgccc      1200
     gcgcgcccca ccgcccgggt gatcgaagag gcctatcgcg cacaagtcac cgaagagggc      1260
     gcccgccacc cggtcaccgc ccaactggac agcgccgggg aatggggccg ctggctgcgt      1320
     cagatcgagg tcacgcagga ttcaggccat gtgctgatga gcggggtcga gggccggccg      1380
     ctgctggtgc tcgaccgggt gggcgagggg cgggtggcgc tgctggccac cgatcacgcc      1440
     tggctctggg ggcgtggtta cgagggcggc ggcccgcagc tggagctgct gcgccgcctg      1500
     gcgcattgga tgatgaagga acccgaactg gaggaagacg cgctctgggc cgaggcgcag      1560
     ggccagacca tgcggatcat ccggcggacg ctggacactt cggtcggctc ggtcacgatc      1620
     acccgccccg atggcggtga ggatgtgctg ccgatggagg aggtgtctcc gggccggttc      1680
     gaggcgctgt atcagggacc tgagatcggc ctttaccggc tgcgcgaagg cgatcagagc      1740
     gcggtcatcg gcctgggtcc ggcggccccg cgcgagttcg aggcgaccat cgccaccgcc      1800
     gccctgatgg agccgctgat caccccgctc aagagtggta tcttccggct ggaggacggc      1860
     ttgcccacca tccgcaacgt gcgcgagggg cggcccgccg ccgggcgcgg ctggctgggc      1920
     ctgaccccgc gcggcgccta tgaaacccgc gacgtgcggc agactccgct ggccccggcc      1980
     tggctggtgc tgttgctggc ctcgggcttt gtcatagccg gctggctgcg cgaagggcgt      2040
     cgctaa                                                                 2046
//

If you have problems or comments...

PBIL Back to PBIL home page