(data stored in ACNUC7421 zone)

EMBL: CP000031.PE135

CP000031.PE135       Location/Qualifiers
FT   CDS_pept        complement(150642..153404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0137"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:D97630; match to
FT                   protein family HMM TIGR02226"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93465"
FT                   /db_xref="GOA:Q5LWT0"
FT                   /db_xref="InterPro:IPR011933"
FT                   /db_xref="InterPro:IPR024163"
FT                   /db_xref="InterPro:IPR025297"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWT0"
FT                   /protein_id="AAV93465.1"
FT                   /translation="MTVLGGIGFTAPWLLLALVALPILWLILRAVPPAPIRRLFPAVSL
FT                   LLGLRDDESVSDRTPWWLLLLRVLAVAAVILGLAGPVLNPRQQAEGDQPLLMVMEASWA
FT                   GAARWTQQIDLLEARLTEAGRASRPVAVLRLGAPEDLVFQSAAAWRSRLPGLSPMPWQP
FT                   GAAELAAATQAIAAQTGGFDTLWLSDGLDYAGRAELLDTLGARGAVTVYQSPNPVLGLR
FT                   PASFADGAVQLTLLRAEAGEERIQPVLALGPDPAGTVRVLNRSEARFASGETEAQLALA
FT                   LPSELRARITRFELEGQRAAGAVALTDDSLARHEVALYAGRQDREGLELLSPLHYLTQV
FT                   LAPNSDFIDGALLDVLPANPDIVVLADVVTLATLERSALTEWVEQGGILVRFAGPRMAA
FT                   SDIGRDNADPLLPVRLRSGGRTVGGAMSWGEAKTLAPFGDTSPFYGLTIPDDVTVSTQV
FT                   MAQPDPDLADRVIAALSDGTPLVTRKALGLGQVVLFHVTADAEWSSLPLSGLYVEMLDR
FT                   LAVSSAAKSADAINMEGTVWSPLRVMDGFGQLDDAGNLPGIDGTALATAPIGPEMRPGV
FT                   YANDSRRLARNVLGADSVLTPATWPASVPVLGLSIAAEQPLGGWLLSLALVLLALDVAA
FT                   SLALSGRLGPLGRAAALLALLLHAPVAEAQLTEADMFARDATREMVLAHVLTGNRAVDD
FT                   LALAGLRGLSDTLFFRTSVEPAAPFSVDLERDELAFFPLLYWPVTPDQPQPSDAAYARL
FT                   NTYLRLGGMILFDTRDADIARFGASSPNGRKLQQLAAPLDIPPLEPVPGDHVLTRTFYL
FT                   LQDFPGRHASADIWVEAAPLDAEQIEGMPFRNLNDGVTPVVIGGNDWAAAWAVDDNGRA
FT                   MLPVGRGYGGERQRELAYRFGVNLVMHVLTGNYKSDQVHVPALLDRLGQ"
     atgacggttc tgggcggcat cggctttacc gcgccctggc tgctgctggc gctggtggca        60
     ttgccgatcc tctggctgat cctgcgcgcg gtgccaccgg cgccgatccg tcggctgttc       120
     ccggcggtca gcctgcttct gggcctgcga gacgacgaaa gcgtgtctga cagaaccccc       180
     tggtggctgc tcttgctgcg ggtcctggcg gtggcggcgg tgatccttgg cctggccgga       240
     ccggtcctca atccccggca acaggccgag ggcgaccagc ccctgctgat ggtgatggag       300
     gccagctggg ccggggcggc gcgctggacg caacagatcg acctgctcga ggcgcggctg       360
     accgaagcgg gccgggccag ccgcccggtt gcggtgctgc ggctgggcgc gcctgaggat       420
     ctggtgtttc aatccgccgc cgcctggcgc agccggctgc ccggcctgtc gccgatgccc       480
     tggcaaccgg gcgcggcgga actggccgcc gccacacagg cgatcgcggc acagacgggc       540
     gggttcgaca cgctctggct cagcgacggg ttggactacg cggggcgggc cgaactgctc       600
     gacacgctgg gcgcgcgcgg cgcggtcacc gtctatcaat cgcctaaccc ggtactgggt       660
     ctgcgcccgg ccagtttcgc cgatggcgcg gtgcagctga cgctgctgcg ggccgaggcg       720
     ggcgaggagc gcatccagcc ggtgttggcg ctgggccccg atcccgccgg aacggtgcgg       780
     gtactcaatc gcagcgaggc gcgctttgcc agtggcgaga ccgaggcgca gctggcgctg       840
     gcgctcccct cggaattgcg ggcgcgcatc acccggttcg agcttgaagg acagcgcgcc       900
     gccggcgcgg tggcgctgac cgatgacagc ctggcccggc acgaggtcgc gctttatgcc       960
     gggcggcaag atcgcgaggg gctggagctg ctctcgccgc tgcattacct gactcaggtg      1020
     ctggcgccca attccgattt catcgacggc gctctgctgg atgtgctgcc cgccaatccc      1080
     gatatcgtgg tgctggccga tgtggtgaca ctggccacgc tggaacgaag cgcgctaacc      1140
     gaatgggtgg aacagggcgg cattctggtc cgctttgccg gtccccgcat ggcggccagc      1200
     gatatcggcc gcgacaatgc cgatccgctg ctgccggtcc gcctgcgcag cggcggccga      1260
     accgtcggcg gcgccatgag ctggggcgag gccaagacgc tggctccctt tggtgatacc      1320
     tcgccctttt acgggctcac gattcctgac gatgtcaccg tgtcgaccca ggtcatggcc      1380
     cagcccgacc ccgatctggc cgatcgggtg atcgccgcgc tcagcgacgg cacaccgctg      1440
     gtcacccgca aggcactggg gctgggacag gtggtgctgt tccatgtcac cgccgacgcg      1500
     gaatggtcaa gcctgccgct gtcaggcctt tatgtcgaga tgctggatcg tctggccgtc      1560
     tcctcggccg ccaagagcgc cgatgccatc aacatggaag gcacggtatg gagccccctg      1620
     cgggtgatgg acgggttcgg gcagttggac gatgccggca acctgcccgg catcgacggc      1680
     accgccctgg ccacggcacc gatcgggccc gagatgcgcc cgggtgtcta tgccaatgac      1740
     tctcgccggc tggcgcgcaa cgtcttgggc gccgacagcg tgctgacccc ggcgacgtgg      1800
     cccgcatcgg ttccggtgct gggtctgagc atcgcggccg agcaaccgct gggcggctgg      1860
     ctactgtcgt tggcgctggt gttgctggcg ctggatgtgg cggcctcctt ggccctatcg      1920
     ggccgcctcg gcccgcttgg ccgcgccgca gccctgctgg ccctgctgct gcacgccccc      1980
     gtggccgagg cgcaactgac cgaggccgac atgttcgccc gcgacgccac ccgcgagatg      2040
     gtgctcgcac atgtgctgac cggcaatcgc gctgtggacg acctggcgct ggccgggctg      2100
     cgcggcctgt cggacacgtt gttctttcgc acctcggtcg aacccgcagc gccgttcagc      2160
     gtcgatctcg aacgcgacga gctggccttt ttcccgctgc tctattggcc ggtcaccccc      2220
     gatcagccgc agccttcgga tgcggcctat gcccggctca acacctatct gcggctgggc      2280
     ggcatgatcc tgttcgacac ccgcgacgcc gatatcgccc gctttggcgc cagcagcccg      2340
     aacgggcgca agctgcaaca actggcggcg cctttggaca ttccaccgct ggagccggtg      2400
     ccgggcgatc atgtgctgac ccgcacattc tacctgcttc aggatttccc tggccgtcac      2460
     gccagcgccg atatctgggt cgaggccgcc ccgctcgatg ccgaacagat cgagggcatg      2520
     ccctttcgta atctcaatga cggggtcact ccggtggtga tcggcggcaa cgattgggcc      2580
     gccgcctggg cggtcgatga caatggccgc gccatgctgc cggtggggcg cgggtatggt      2640
     ggcgagcggc aacgcgagct tgcctatcgc tttggcgtca atctggtcat gcatgtgctg      2700
     accggcaatt acaaatccga tcaggtccat gtgcctgcgc tgcttgacag gttgggacaa      2760
     tga                                                                    2763
//

If you have problems or comments...

PBIL Back to PBIL home page