(data stored in ACNUC9435 zone)

EMBL: CP000031.PE139

CP000031.PE139       Location/Qualifiers
FT   CDS_pept        complement(155946..156515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0141"
FT                   /product="DNA binding protein, putative"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93469"
FT                   /db_xref="GOA:Q5LWU4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWU4"
FT                   /protein_id="AAV93469.1"
FT                   /translation="MTENSDDILNRLPARLKEARRAQGLSLEAVANLSGVSRSMVSQIE
FT                   RGESSPTIATLWNLTRALQVDFAGLLEAAEAADRIDTLRASEVPSIDNMGQGCRIRILS
FT                   PPEDAGGHEVYDISFKPGGTLNSQPHARGTREQLTVLDGAVRVTSGAAAQDLGPGDTAR
FT                   YAADIPHKISASGDGPARVFLIVKTA"
     atgacggaaa actccgacga tatcctgaac cgcctgcccg cccgcctgaa agaggcgcgc        60
     cgcgcgcagg gcctctcgct cgaggcggtg gccaatctca gcggcgtctc acgctccatg       120
     gtcagccaga tcgaacgagg tgaaagcagc ccaaccatcg ccacgctgtg gaacctgacg       180
     cgcgcgcttc aggtcgattt cgcgggcctg ctcgaggccg ccgaggccgc cgaccgtatc       240
     gacaccttgc gcgcctccga ggtgcccagc atcgacaata tgggccaggg ttgccgcatc       300
     cgcatcctgt ccccgcccga agacgcgggt gggcacgagg tctatgacat cagcttcaaa       360
     ccgggcggca cgctgaacag ccaaccccat gcgcgtggca cccgagaaca gctgaccgtg       420
     cttgacggtg cggtacgtgt gacatcgggc gccgccgcgc aggacctggg gccgggcgat       480
     accgcgcgct atgccgccga cattccacac aagatctctg cctccggcga cggaccggcg       540
     cgggtgttcc tgatcgtcaa gaccgcctga                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page