(data stored in ACNUC7421 zone)

EMBL: CP000031.PE141

CP000031.PE141       Location/Qualifiers
FT   CDS_pept        complement(158208..159194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0143"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /note="identified by match to protein family HMM PF00037"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93471"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWU2"
FT                   /protein_id="AAV93471.1"
FT                   /translation="MARTNPHRPFVPDPEQAALAPGVSGNDINGLGETAFRRPRMVYWA
FT                   PDPDDIPHGSLQRYFYRQSAKEPDFASRRAARQAVLDAPLPLLADTVVIRDPADWTAAL
FT                   TQFVDSGLCDLTGVAEMNPDWVFEGHEIPQSRVIMIGVAHDYNVIATAPKPSAGLEVMT
FT                   QYTRAAQAAKTIAGWLRQQGWQAEPLTGPMTGALAMIPPALACGFGELGKHGSIINPDL
FT                   GASFRLSAVLSDAPFAPTPAQDHGIDGFCQNCHICQDACPPEALFAQKQTVRGARKWYV
FT                   DFDKCLPFFNQTHGCAICIAECPWSRPGIGPNLAAKLARKRNRDATG"
     atggctcgca ccaatccaca tcgccccttc gtgcccgatc ccgaacaggc agcccttgcg        60
     cccggggtca gcggcaatga catcaacggg ctgggcgaaa cagcgtttcg ccgcccgcgc       120
     atggtctatt gggcgcccga tccggacgac atcccgcatg gatccctgca acgctatttc       180
     taccggcaat ctgcgaaaga acctgacttt gccagcagac gcgctgcccg ccaggcggta       240
     ctggacgcac ccctgccttt actggccgac accgtcgtca ttcgcgaccc cgcggactgg       300
     actgccgcgc tgacccaatt cgtggacagc ggcttatgcg atctgaccgg ggtcgccgaa       360
     atgaaccccg actgggtctt cgaaggccac gagattcctc aatcccgcgt catcatgatc       420
     ggcgtggccc atgactacaa cgtcatcgcc accgcgccca agccaagcgc cgggcttgag       480
     gtgatgaccc aatacacccg cgccgcccag gccgccaaga ccatcgccgg atggctgcgc       540
     cagcagggtt ggcaggccga gcctttgacc ggcccgatga ccggcgcatt ggcgatgatc       600
     ccgccggcgc tggcctgcgg ctttggcgag ctgggcaagc acgggtccat catcaacccg       660
     gaccttggtg cctcgtttcg cctgtcggcg gtgctgagcg atgcgccttt tgccccgacg       720
     ccggcgcagg atcacggcat cgacggtttc tgccagaact gccacatctg tcaggacgcc       780
     tgcccgcccg aggcgctgtt tgctcaaaag cagaccgtgc gcggcgcccg caagtggtat       840
     gtcgattttg acaaatgcct gcccttcttc aaccagaccc acggctgcgc catctgcatc       900
     gccgaatgcc cctggtcccg ccccggcatc ggcccgaacc tggccgccaa actggcccgc       960
     aaacgcaaca gggacgcgac cggctga                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page