(data stored in ACNUC7421 zone)

EMBL: CP000031.PE15

CP000031.PE15        Location/Qualifiers
FT   CDS_pept        15491..16264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93346"
FT                   /db_xref="GOA:Q5LWG6"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWG6"
FT                   /protein_id="AAV93346.1"
FT                   /translation="MEPAGQGVSVRPKPAIGEQNMKIAMWSGPRNLSTAMMYAFGARTD
FT                   CAVIDEPFYAAYLAMTGLHHPMREEVLAAQSQDPGQVAAMLSGPNPGARPFWYQKHMTQ
FT                   HMIPGIPRDWMRSVCNVFLIRHPARVIASYAEKRENPTLEDIGFRQQAELFDEVSGWGG
FT                   DPLVIDSHDIREDPARMLERLCDRIGVPWSPHMLSWPKGGHKDDGVWARHWYGAVWNST
FT                   GFAGPEGDLPEVPEALQPVLQAAMPFYERMRAVKI"
     ttggaaccgg ccgggcaggg cgttagcgtg cggccaaaac cggcaatcgg agagcagaac        60
     atgaaaatcg ccatgtggtc ggggccgcgc aatctgtcga cggcgatgat gtacgccttt       120
     ggcgcccgga ccgattgcgc ggtgatcgac gagccgttct atgccgccta tctggcgatg       180
     accggactgc atcatccgat gcgcgaagag gttctggccg cccagtcgca agacccaggt       240
     caggtggcgg caatgctaag cgggcccaat cccggggcgc ggccgttctg gtatcagaag       300
     cacatgacgc agcacatgat ccccggcatc ccgcgcgact ggatgcggtc ggtctgcaac       360
     gtgttcctga tccgccatcc ggcgcgggtg atcgccagct atgccgaaaa gcgcgagaac       420
     ccgacgctgg aagatatcgg ttttcgtcag caggcggaac tttttgacga ggtgtctggc       480
     tggggcggcg acccattggt catcgacagc cacgatatcc gcgaagatcc ggcgcggatg       540
     ctggaacggc tctgcgaccg gattggcgtc ccgtggtcgc cgcatatgct gagttggccc       600
     aagggcggcc acaaggatga tggagtctgg gcgcggcact ggtacggggc ggtctggaac       660
     tcgaccggat tcgcagggcc cgaaggcgat ttgcccgagg ttccagaggc gttgcagccg       720
     gtcttgcaag ccgcgatgcc attttatgag cgcatgcgcg ccgtcaagat ttga             774
//

If you have problems or comments...

PBIL Back to PBIL home page