(data stored in ACNUC7421 zone)

EMBL: CP000031.PE150

CP000031.PE150       Location/Qualifiers
FT   CDS_pept        168274..168894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0152"
FT                   /product="transporter, LysE family"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93480"
FT                   /db_xref="GOA:Q5LWV1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWV1"
FT                   /protein_id="AAV93480.1"
FT                   /translation="MTLSAVDLALYAGAVFVLFLTPGPVWLALTARTLSGGFQAAWPLT
FT                   LGVVVGDSLWPVLAVLGIGWITAASTQIALALKVVAVLVFVTLGIVTIRNADRTIASDS
FT                   RLTRPGIWAGFLAGLVVILGNPKAVLFYMGILPGFFDLSDITTIDLVAIVAVSQVVPLV
FT                   GNLMLAAFVDRVRRVLSSPRALRRMNLTAGGMLIVVGLILPFT"
     atgaccctgt cggcggttga tctggcgcta tatgccgggg cggtttttgt gctgttcctg        60
     acgccggggc cagtctggct ggcgctgacg gcgcgcactc tgtctggtgg gtttcaggct       120
     gcctggccgc taacgctggg cgtggtggtg ggcgacagcc tgtggccggt tctggcagtt       180
     ctgggtatcg gctggatcac ggctgcctcg acccagatcg cgctggcgct caaggtggtt       240
     gcggtgctgg tctttgtcac tttggggatc gtcacgatcc gaaacgccga ccgcaccatc       300
     gccagtgaca gccggttgac ccggcccggt atctgggccg ggtttctggc ggggctggtg       360
     gtgatcctgg gcaatcccaa ggcggtgttg ttctatatgg ggatcttgcc gggtttcttc       420
     gatctatccg atatcaccac catcgacctt gtcgccatcg tggccgtgtc gcaggtggta       480
     ccgctggtgg gcaatctgat gctggccgcc tttgtcgatc gggtgcggcg ggtgctgagt       540
     tcgccccgcg cgctcaggcg gatgaacctg acggcgggtg gtatgttgat cgtggtcggg       600
     ttgatcctgc cctttacgtg a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page