(data stored in ACNUC7421 zone)

EMBL: CP000031.PE151

CP000031.PE151       Location/Qualifiers
FT   CDS_pept        complement(168887..169474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0153"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93481"
FT                   /db_xref="GOA:Q5LWV0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWV0"
FT                   /protein_id="AAV93481.1"
FT                   /translation="MTRPPQKRRLETRARLLAEAARLVEAQGYAGLRVEDVVEAAGVAK
FT                   GTLFSHFTDKDGLLAVLIGAEVMRLIDGMETAGPPDDLPQLMHRLAPLLDFIASDRVIF
FT                   DLLLRYSGSTGAERNEVVADGFYRQIDLWAGWIAGMQAAGTVRGDHPPALLAEGIQAFL
FT                   NQIIAIRFCQGGQATGTPAGALYPFLAAWLIT"
     atgacccggc cgccgcagaa acgccgcctg gaaacccgcg cccgcctgtt ggccgaggcc        60
     gctcggctgg tcgaggcgca gggatatgcc gggctgcggg tcgaggatgt ggtcgaggcc       120
     gctggcgtcg ccaagggcac actgttttcc catttcaccg acaaggatgg cttgctggct       180
     gtcctgatcg gtgccgaggt gatgcgactg atcgacggta tggagaccgc aggacccccc       240
     gatgacctgc cgcagctgat gcatcgtttg gcgccgctgc tggacttcat cgccagtgat       300
     cgggtgatct ttgatctgct tctgcgctat tccggttcta ccggggccga acggaacgag       360
     gttgtggccg atgggttcta ccgtcagatc gacctttggg cgggttggat cgcgggcatg       420
     caggcggcgg gcaccgttcg cggcgatcat cccccggccc tgttggccga gggcattcag       480
     gccttcctca accagatcat tgcgatccgc ttctgtcagg gcggtcaggc caccggcaca       540
     ccagccgggg cgctctatcc ctttctggcc gcctggctga tcacgtaa                    588
//

If you have problems or comments...

PBIL Back to PBIL home page