(data stored in ACNUC7421 zone)

EMBL: CP000031.PE156

CP000031.PE156       Location/Qualifiers
FT   CDS_pept        177007..178419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0160"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:D75521"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93486"
FT                   /db_xref="GOA:Q5LWW1"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWW1"
FT                   /protein_id="AAV93486.1"
FT                   /translation="MTEESKTYDPVTGEHLKDWGHRPGKQFPALLARANEMRAAGLGLV
FT                   RIRMELEVEIPPAPVTHDLRAPGEVPFHENIDIAGPDEEDNVQKVRETMTALMRTPTIE
FT                   AGAIMPDACPAGPVGTIPVGGVAAARNAIHPGMHSADICCSVMITDLGHADPKTVLDAA
FT                   QSVTHFGPGGRPQGNRFTVSLDLLDAFRANAFLSNPKALRMAQEHLGTQGDGNHFLFVG
FT                   RSRKTGRTAIVTHHGSRGPGAVLYKLGMEVAERFRRELSPGTAKQNAWIPADTDEGRDY
FT                   WAALQLIRKWTKANHNAIHQATVEAARAEAGDRFWNEHNFVFRRGDIYLHGKGATPAWG
FT                   DYAADATGLTLIPLNMSEPVLVVRGKDAARGLGFSPHGAGRNFSRSEHKRRMGKMTPEA
FT                   MLKAETEGLDIRFHAGGVDASELPSSYKKAGSVVDQIRSYDLAEIEDYIDPYGCIMAGE
FT                   VPPFWAKKKTRR"
     atgaccgaag agagcaagac atatgacccg gtgacgggtg agcacctgaa ggactggggg        60
     catcggcccg gcaagcagtt tcccgcgctt ctggcgcggg cgaacgagat gcgcgcggcg       120
     ggccttggcc ttgtccggat acggatggaa ctggaggtcg agatcccgcc cgcgccggtg       180
     acacatgatc tgcgcgcgcc cggcgaggtt ccgtttcacg agaatatcga catcgccggc       240
     ccggatgagg aggacaatgt ccaaaaggtc cgcgagacga tgaccgcact tatgcgcacg       300
     ccgacgatcg aggcgggggc gatcatgccc gatgcctgcc cggcgggccc ggttggcacg       360
     atcccggtgg gcggcgtggc ggcggcgcgc aatgcgatcc atcccggcat gcattcggcc       420
     gatatctgct gttcggtgat gatcaccgat ctgggtcatg cggacccgaa aacggtgctg       480
     gacgcagcgc aatcggtgac gcatttcggc cccggcgggc gtccgcaggg caaccggttc       540
     accgtatcgc tcgatttgtt ggacgcgttt cgtgcgaatg cgttcctgtc gaaccccaag       600
     gcccttcgca tggcgcagga gcatttgggg acgcaaggcg acggcaacca tttcctgttt       660
     gtcggccggt cgcgcaagac cgggcgcacg gccatcgtga cccatcacgg atcgcgcggg       720
     ccgggggctg tgctgtacaa gttgggcatg gaggtggccg agcggttccg gcgcgaatta       780
     tcgcccggaa cggcgaagca gaacgcctgg attccggccg ataccgacga ggggcgtgac       840
     tactgggcgg cgctgcaact gatccgcaaa tggaccaagg ccaaccacaa cgccatccat       900
     caggcgacgg tggaggccgc gagggccgaa gcgggcgacc ggttctggaa cgaacacaat       960
     ttcgtctttc ggcgcggcga catctacctg cacggcaagg gcgcgacacc ggcctggggc      1020
     gactatgccg ccgacgcgac ggggctgacg ctgatcccgc tcaacatgtc cgagccggta      1080
     ctggtcgtgc gcggcaagga tgcggcgagg ggcctcggtt tcagcccgca tggcgctggg      1140
     cgcaacttct cgcggtccga gcacaagcgg cgcatgggca agatgacgcc cgaggcaatg      1200
     ctgaaggccg agacggaagg gctcgacatc cgcttccatg cgggtggggt cgacgcgtcc      1260
     gaactgccgt cgagctacaa gaaggcgggg tcggtggtcg atcagatcag gtcttatgat      1320
     ctggctgaga tcgaggatta catcgatccc tatgggtgca tcatggccgg tgaggtgccg      1380
     ccgttctggg ccaagaagaa aacgcgccgc tag                                   1413
//

If you have problems or comments...

PBIL Back to PBIL home page