(data stored in ACNUC7421 zone)

EMBL: CP000031.PE157

CP000031.PE157       Location/Qualifiers
FT   CDS_pept        complement(178533..179147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0161"
FT                   /product="DNA-binding response regulator, LuxR family"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93487"
FT                   /db_xref="GOA:Q5LWW0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWW0"
FT                   /protein_id="AAV93487.1"
FT                   /translation="MRILLADDHALVRDTISVYLQSEGDAEVVAVPDLGAAMRAADTEG
FT                   PFDLILLDFNMPGMNGLDGLRAAIRHAPDTPVALLSGSAPNRVAQEAVDAGAAGFVPKT
FT                   LAAKSLLHAVRFMIAGEVFVPSTVLQAPEAPSDGGLTATLSRREKQVLGGLCRGLPNKE
FT                   IARELDLQEVTIKLHVRTLCKKLNAKNRTQAAMIARDAGFE"
     atgcgaatac ttctggccga cgatcacgcc ttggtacggg atacgatctc ggtctacttg        60
     cagagcgagg gtgatgccga ggtggtcgca gtgcccgatc tcggcgccgc aatgcgggcc       120
     gccgataccg agggtccttt cgatctgatc ctgcttgatt tcaacatgcc cggaatgaac       180
     ggcctggatg gtttgcgtgc ggccatccgc catgcgcccg atactccggt cgcgctgctc       240
     agcggaagcg cccccaatcg ggtcgcacaa gaggcggtcg atgcgggcgc tgccggtttt       300
     gtccccaaga cgctagcggc caagagcctg ttacacgccg tgcgcttcat gatagccgga       360
     gaggtctttg tgccaagtac cgtcctgcaa gcgcccgaag ccccctcgga cggcggattg       420
     accgcgactc tcagccggcg cgagaaacag gtgctcggcg gattgtgtcg cggcttgccc       480
     aacaaggaga tcgcccgcga gctggacttg caggaagtga cgatcaagct gcatgtccgt       540
     accttgtgca agaagctgaa cgccaagaac cgcacccagg ccgcgatgat cgcaagggac       600
     gcgggtttcg aatag                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page