(data stored in ACNUC9435 zone)

EMBL: CP000031.PE158

CP000031.PE158       Location/Qualifiers
FT   CDS_pept        179479..179967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0162"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAQ59886.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93488"
FT                   /db_xref="GOA:Q5LWV9"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWV9"
FT                   /protein_id="AAV93488.1"
FT                   /translation="MRMRAIGRVPILVAGLLLASVGQVAKAGEEVLAVTGSDGSAISFD
FT                   LDALRALPVSEIRTSTIWTDGIQVFQGVSLRDLLDHVDAVEGTITAVALNDYLIDIPTS
FT                   DATRPGPVVAYLRNGEQMSVRDKGPLWIIYPYDDNPDYNTEEYYARSIWQLIRLEVPK"
     gtgaggatga gggcgatcgg acgcgttcca attctggtgg ccggattgct tctcgcgagt        60
     gttgggcagg tggcaaaggc gggagaagag gtacttgccg ttaccggttc cgatggctct       120
     gccatcagtt tcgatctgga cgcgctaagg gcgctgccgg tcagcgagat ccgcacaagc       180
     accatctgga ccgacgggat tcaggtattt cagggcgtct ccttgcgcga tctgctggat       240
     catgtggatg ccgttgaggg cacgatcact gccgtggcgc tgaacgatta cctgatcgac       300
     atcccgacct cggatgcaac gcggcccggc ccggtggtgg cgtatctgcg caacggcgaa       360
     cagatgtcgg tacgcgacaa ggggcccttg tggatcatct atccctatga cgataatccg       420
     gattataaca ccgaagaata ttatgcccgc agcatctggc agctgatccg gctggaggtg       480
     ccaaagtaa                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page