(data stored in ACNUC7421 zone)

EMBL: CP000031.PE159

CP000031.PE159       Location/Qualifiers
FT   CDS_pept        180023..182494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0163"
FT                   /product="sensory box histidine kinase/response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00512; match to protein
FT                   family HMM PF00989; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93489"
FT                   /db_xref="GOA:Q5LWV8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWV8"
FT                   /protein_id="AAV93489.1"
FT                   /translation="MKTGFWIALVLVLIGYSALLGREAMVRLDTLSTAASDDIRWNMSQ
FT                   LEVELLRLQSAALKARDGGQGDIQQLRTRFDIFYSRTQIVLRGALYDQAREIPEVQERL
FT                   QSLRAFLAESVPIIDAPEPILADRLPELAHLVEQVSPEVRDLALTIVNTSARAADTQRL
FT                   KVSETLRRLALSVLGLLVALTIVALLLLRLYRSSQVVSAEKEAVKSRFEAAVKSALDAV
FT                   LVVDTEGHIIEFNGGAEAMFGYSRSEALGQPMSDLIIPPHYRARHEEGMRRFREHGTSR
FT                   VVGRGHLRLEGMRKSGEVFPIELSISLAETSDQLVFISFLRDITNRLKTEDDLREARDT
FT                   AQAGAQAKAQLLTVMSHEMRTPLNGILGSLDLMERDELSPKQVRLVRAIRVSGELLLTQ
FT                   VNRVLDLSRLESGMIEFPKEPFALLPMVRRLTESLTAAAEERGNRLQTTLVGDDPGVVL
FT                   GNRIALQQALVNLLGNAIKFTRNGEISLEVERLNDDRMIEFRISDTGLGIPAKDIERIF
FT                   DEFVTIDTAYARENPGTGLGLSITRRLVWAMGGEIEVESIEHEGSLFLIRLPLEPGEAV
FT                   ELASEKERGQPEPGPLKGKRVLVIEDNDINRMLLLDMLEEFGCQVVLARDGFEGVAAAK
FT                   SARYDLLLVDISMPGKDGLETLREIRAQEGPNGPVRAIAITANVRDEDKERFAAAGFDG
FT                   FLAKPISMLQLQEMLSGLLLRPEAEAERSTAREFIRRFGMAEYQRHLLGMVDALHAVCD
FT                   DLANTELSETLKARVHEQAGSAAILGRADLHSLLQEIEATDAADWPARRGGMLDRLKTE
FT                   LARTRAVSLGG"
     ttgaagaccg gtttctggat tgcactcgtg ctggtgctga tcgggtattc ggcgctgctc        60
     ggtcgcgagg cgatggtgcg gctcgacacc ctgtcgacag cggcgtcgga cgatatccgc       120
     tggaacatgt cgcagctcga agtcgaactg ctgcgacttc agagcgcggc gctcaaggcg       180
     cgcgacggag ggcagggcga tatccagcag ttgcgaaccc ggttcgacat tttctacagc       240
     cgcacccaga tcgtgctgcg cggggcgctt tatgatcagg cgcgcgagat tcccgaagtg       300
     caggagcggc tgcagtcgct gcgggcgttc ctggccgaaa gcgtgccgat catcgatgcg       360
     cctgaaccga tacttgccga ccgtctgccc gagttggcgc acctggtcga acaggtgtcg       420
     cccgaggtgc gggacctggc gctgacgatc gtcaatacct cggcccgtgc cgctgatacc       480
     cagcggctga aagtgtccga gaccctccgg cggctggcgt tgtcggtgct gggattgctg       540
     gtggcgctga caatcgttgc gctgctcttg ctgcggctct accgcagcag tcaggtggtc       600
     tcggcggaaa aggaggcggt gaaatcgcgg ttcgaggctg cagtgaaatc tgcgctggat       660
     gcggtgctgg tggtggatac cgagggccat atcatcgaat tcaacggcgg tgccgaggcc       720
     atgttcggct attcccgcag cgaggcgctg ggccagccga tgtccgacct gatcatcccg       780
     ccccattacc gcgcccgcca cgaagagggg atgcgacggt ttcgcgaaca tggcaccagc       840
     cgggtggtcg gcaggggcca cctgcgtctg gaggggatgc ggaaatcggg cgaggtgttt       900
     ccgatcgaac tgtcaatctc gctggccgag accagcgacc agctggtgtt catctcgttc       960
     ctgcgggaca tcaccaaccg gctgaagacc gaagacgatc tgcgcgaggc gcgcgatacc      1020
     gcacaggcgg gcgcccaggc caaggcgcag ttgttgacag tgatgagcca cgaaatgcga      1080
     acgccgctga acggcattct cggctcgctg gacctgatgg aacgtgacga gctgtcgcca      1140
     aagcaggtgc gcctggtgcg ggcgatccgg gtctcgggcg agctgttgct gacccaggtc      1200
     aaccgggttc tcgacctgtc gcggctggaa tccggaatga tcgagttccc gaaagaaccc      1260
     tttgcgctgt tgccgatggt ccggcgcctg accgagagcc tgaccgctgc cgccgaagag      1320
     cggggcaacc ggctgcaaac cactctggtc ggtgacgatc cgggagttgt gttgggcaac      1380
     cggatcgcct tgcaacaggc cctggtgaat ctgctgggaa acgcgatcaa gttcacccgc      1440
     aacggcgaga tttcactgga agtggagagg ttgaacgatg accggatgat cgagttccgc      1500
     atatcggata ccggtctggg cattcccgcc aaggatatcg agcggatttt cgacgaattc      1560
     gtcaccatcg acaccgccta tgcccgcgaa aacccgggca ccgggttggg gctcagcatc      1620
     acccggcggc tggtctgggc catgggcggc gagatcgagg tcgaaagtat cgagcatgag      1680
     ggcagcctgt tcctgatccg cttgccgctg gagccgggag aagcggttga actcgccagc      1740
     gagaaagaac ggggccagcc ggaacccgga ccactgaagg gcaagcgggt gctggtgatc      1800
     gaggataacg acatcaaccg gatgctgctt ctggacatgc tggaggagtt cggctgtcag      1860
     gtcgtgttgg cccgcgacgg gttcgagggc gttgccgccg ccaaaagtgc ccggtacgat      1920
     ctgttgctgg tcgatatcag tatgccgggc aaggacgggc tggagacctt gcgagaaatc      1980
     cgggcacaag agggccccaa tggccccgtg cgcgccatcg cgatcaccgc caatgtgcgc      2040
     gacgaggaca aggagaggtt cgccgccgcc gggttcgacg gatttctggc caagccgatc      2100
     tcgatgctcc agctgcaaga gatgttgagc ggcctgctcc tgcggcccga ggccgaggca      2160
     gagcgctcga ccgcgcggga gttcatccgc cggttcggaa tggcagagta tcagcgtcac      2220
     cttttgggca tggtcgatgc gctgcatgcg gtttgcgatg atctcgccaa cacggagctg      2280
     agtgagacgc tcaaggcgcg ggtgcatgaa caggccgggt cggcggcgat tctgggtcgt      2340
     gctgatctgc attcattgct gcaagagatc gaggcgacgg atgccgctga ctggcccgcc      2400
     cgccggggtg gaatgctgga tcggctcaaa accgaattgg cgcggacacg ggctgtgtcc      2460
     ttgggcggtt ag                                                          2472
//

If you have problems or comments...

PBIL Back to PBIL home page