(data stored in ACNUC9435 zone)

EMBL: CP000031.PE162

CP000031.PE162       Location/Qualifiers
FT   CDS_pept        complement(185200..187245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0166"
FT                   /product="N-methylproline demethylase, putative"
FT                   /note="identified by similarity to SP:O87278; match to
FT                   protein family HMM PF00724"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93492"
FT                   /db_xref="GOA:Q5LWW9"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWW9"
FT                   /protein_id="AAV93492.1"
FT                   /translation="MSRDPLLQPFQLKHLTLKNRIMTTAHEPAYPEDGMPKQRYAAYHA
FT                   ERARAGVALAMTAGSAAVSRDSPPVFNNILAYKDEVVPWIRQLTDACHDHGCAVMIQLT
FT                   HLGRRTGWNKGEWLPSVSSSRHREPAHRAFPKLAEDWDIARIISDFADAAERMKEGGMD
FT                   GIELQVYGHLLDQFWSPLTNDLDGPYGGQTLESRMKMPLDVLRAVRARVGDDFIVGLRY
FT                   TADEAAEGGIGPEEGIEISKRLADTGMVDFLNVIRGRIHTDPAMTDVIPVQGMKSAPHL
FT                   DFAGEVKKATGMPTFHAARIPDVATARHAVASGLLDMVGMTRAHMADPHIVQKIVEGRE
FT                   DDIRPCVGATYCLDRIYQAGEALCIHNPATGRELTMPHTIPSAQTRKRVVVVGAGPAGL
FT                   EAARVAAERGHHVTVFEAQPDPGGQVRLTAQNPRRREMIGIIDWRMAQCAARDVEFRFN
FT                   TWAEAADVTALNPDVVIVATGGLPNTELFETGRENNLVVSAWDLISGDVKPAQNVLIYD
FT                   ESGDHPALMAAEVAANAGAKVEVMTPDRMFAPDIMGMNLVPYMRALQDKDTTFTVTRRL
FT                   LDVTRDGNQLRARIGTDYSSFTKDQTYDQVVVNYGTMPMADLYFELRPLSRNGGEVDYD
FT                   ALIAGNPQTVETNLDGAFQLFRIGDAVSARNTHAAIYDALRLMKDI"
     atgtcccgtg atccgctgct gcagcccttt cagctgaaac acctgaccct gaagaaccgg        60
     atcatgacca cagcgcatga accggcctat cccgaagacg gcatgccgaa acagcgttat       120
     gcggcctatc acgccgaacg cgcccgcgcg ggcgtggcgc tggcgatgac cgcagggtcg       180
     gcggcggtgt cgcgcgacag cccgccggtc ttcaacaata tcctggccta caaggacgag       240
     gtggtgccgt ggatccggca actgaccgat gcctgccatg atcatggctg cgcagtgatg       300
     atccagctga cccatcttgg ccgtcgcacc gggtggaaca agggcgagtg gctgccctcg       360
     gtcagctcgt cccggcaccg cgaaccggcc catcgcgcct ttccgaaact ggccgaggac       420
     tgggatatcg cccgcatcat ctcggatttc gccgatgccg cggaacggat gaaagagggc       480
     ggcatggacg ggatcgaatt gcaggtctat ggccacctgc tggatcagtt ctggtcaccg       540
     ttgaccaacg acctggacgg gccctatggc ggccagaccc tggaaagccg gatgaagatg       600
     ccgctggatg tgctgcgcgc ggtgcgggca cgggttggcg atgatttcat cgtcggcctg       660
     cgctataccg ccgacgaggc ggcagagggc ggcatcggcc ccgaagaggg gatcgagata       720
     tcaaaacggc tggcagatac cggcatggtc gatttcctga acgtgatccg gggccgcatc       780
     cacaccgacc cggcgatgac cgacgtgatc ccggtgcagg gcatgaaaag cgccccgcat       840
     ctggatttcg cgggcgaggt gaaaaaggcc accggcatgc cgacctttca cgccgcgcgc       900
     atccccgatg tggccaccgc gcgccacgcg gtcgcctcgg gtctgctgga catggtgggc       960
     atgacccgcg cccacatggc cgacccccat atcgtgcaga agatcgtcga ggggcgcgag      1020
     gacgatatcc gcccctgtgt cggggccacc tattgccttg accggatcta tcaggcgggc      1080
     gaggcactgt gcatccacaa cccggccacg gggcgcgagc tgaccatgcc gcacacgatc      1140
     ccctctgccc agacgcgcaa acgtgtcgtg gtggtggggg ccggtccggc ggggctcgag      1200
     gcggcgcgcg tcgccgctga acgcggccac catgtcactg tgtttgaggc ccagcccgat      1260
     cccggcggcc aggtccgcct gaccgcgcag aacccgcgcc ggcgcgagat gatcggcatc      1320
     atcgactggc gcatggccca atgcgccgcc cgcgatgtcg agttccgctt caacacctgg      1380
     gccgaggcgg ctgatgtcac cgctctgaac ccagatgtgg tgatcgtcgc caccggcggc      1440
     ctgcccaata ccgaactgtt cgaaaccggg cgtgagaata acctggtggt cagcgcctgg      1500
     gacctgattt cgggcgatgt gaaaccggcg cagaatgtcc tgatctatga cgaaagcggc      1560
     gatcatcccg cgttgatggc ggccgaggtc gccgccaatg cgggtgcaaa ggtcgaagtg      1620
     atgaccccag accgtatgtt cgcacccgac atcatgggca tgaacctggt gccctacatg      1680
     cgcgcgctgc aggacaagga caccaccttt accgtcaccc ggcgcctgct ggacgtgacc      1740
     cgcgacggca accagctgcg cgccaggatc ggcaccgatt acagcagctt caccaaggat      1800
     cagacctatg atcaggtggt ggtgaactat ggcaccatgc cgatggccga tctctacttc      1860
     gaactcaggc cgctgtcgcg caacgggggc gaggtcgact atgacgcgct gattgcaggc      1920
     aacccgcaga cggttgaaac caacctggat ggcgcgttcc agctgttccg catcggcgac      1980
     gcggtcagcg cccgcaacac tcacgcggca atctatgacg cgctgaggct gatgaaggat      2040
     atctga                                                                 2046
//

If you have problems or comments...

PBIL Back to PBIL home page