(data stored in ACNUC9435 zone)

EMBL: CP000031.PE163

CP000031.PE163       Location/Qualifiers
FT   CDS_pept        complement(187255..188823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0167"
FT                   /product="trimethylamine methyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF06253"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93493"
FT                   /db_xref="GOA:Q5LWW8"
FT                   /db_xref="InterPro:IPR010426"
FT                   /db_xref="InterPro:IPR038601"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWW8"
FT                   /protein_id="AAV93493.1"
FT                   /translation="MSEQTPLRSRRSRRASGKAGRSAEPGQNLHLRVPYITRKIPTYDL
FT                   LGEESLDKIEATADRILAEIGIELRDDEESMRLYKRAGAQVTELRADAWNIRFEPGMLR
FT                   EILKTAPARFTQHARNPANNVDIGGDAMVFAPAYGSPFVMDMDNGRRYGTIQDFQNLIK
FT                   LGQSSPWLHHSGGTICEPTDIPVNKRHLDMVYSHMRYSDRAFLGSITAPERAADSVEMC
FT                   RILFGADFVDQNCVIMGNFNTTSPLVIDGVTAAGIRTYAAAGQGSIHLPFLLGGAVSPL
FT                   TMAGAVAQCLAESMASSALTQLVRPGAPAILAGFLSSMSLRSGSPTFGTPEPALGSLVM
FT                   GQLARRLNMPLRCAGNFSTSKAPDGQAMQQAMMSMMSAVQGGANYILHSAGFVDGLLSM
FT                   SYEKFVMDTDMCGALHSYLAGIEVNEDTLGFDALAQNGPGEHLFGTDHTLRHYETAYWD
FT                   SGLNDDQTHETWSEQGSADYAIRANKRWKDILNTYEAPVMDDATDEALREFIDRKKASM
FT                   PDAWY"
     atgagcgaac agacacccct tcggtcccgc cggtcccgcc gcgcctctgg caaggcaggc        60
     cgttccgccg agcccggcca gaacctgcac ctgcgcgtgc cctatatcac ccgcaagatc       120
     ccgacctacg atctgctggg cgaggagtcg ctggacaaga tcgaggccac cgccgaccgt       180
     atcctggccg agatcgggat cgaactgcgc gacgacgaag aaagcatgcg gctctacaaa       240
     cgggccgggg cccaggtcac cgagttgcgg gccgatgcct ggaacatccg gttcgagccg       300
     gggatgctgc gcgagatcct gaaaaccgcg cctgcacgct ttacccagca tgcgcgcaac       360
     ccggccaaca atgtcgatat cggcggcgac gcgatggtgt tcgcacccgc ctatggctcg       420
     cctttcgtga tggatatgga caatggccgc cgctatggca ccatccagga cttccagaac       480
     ctgatcaagc tgggccagtc ctcgccctgg ttgcaccatt ccggcggcac catctgcgaa       540
     cccaccgata ttccggtgaa caagcggcac ctggacatgg tctattcgca catgcgctat       600
     tccgaccgcg cctttctggg ctcgatcacc gcgccggaac gggccgccga cagtgtcgag       660
     atgtgccgca tcctgttcgg ggcggacttc gtcgaccaga actgcgtgat catgggcaac       720
     ttcaacacca cttcgccctt ggtgatcgac ggggtgacgg cggcgggcat ccgcacctat       780
     gcggccgccg gacaaggctc gatacacctg cccttcctgc tgggcggcgc ggtgtcaccg       840
     ctgaccatgg ccggagccgt cgcgcagtgc ctcgccgaat cgatggcctc aagcgcgctc       900
     acacagctgg tgcgccccgg tgcacccgcg attctggcgg gcttcctgtc gtcgatgagc       960
     ttgcgctcgg gcagccccac ctttggcacg ccggaaccgg cgctgggttc tctggtgatg      1020
     ggccaactgg cgcgccgcct gaacatgccg ttgcgctgcg ccggcaactt ctcgacctcc      1080
     aaggcgcccg acgggcaggc catgcagcag gcgatgatgt cgatgatgtc ggcggttcag      1140
     ggcggtgcca actacatcct gcattcggcc ggtttcgtcg acgggctgct cagcatgtcc      1200
     tatgagaaat tcgtgatgga caccgacatg tgcggagcgc tgcattccta tctggccggg      1260
     atcgaggtga acgaggatac gctgggcttt gacgcgctgg cgcagaacgg cccgggcgaa      1320
     catctgttcg gcaccgacca caccctgcgc cactatgaaa ccgcctattg ggacagcggg      1380
     ctgaacgacg atcagaccca cgaaacctgg tccgaacagg gcagcgccga ttatgcgatc      1440
     cgcgccaaca agcgctggaa ggacatcctg aacacctacg aggcgccggt gatggacgac      1500
     gccaccgacg aggcgctgcg cgagttcatc gaccgcaaga aagcctccat gcccgacgcc      1560
     tggtactga                                                              1569
//

If you have problems or comments...

PBIL Back to PBIL home page