(data stored in ACNUC9435 zone)

EMBL: CP000031.PE164

CP000031.PE164       Location/Qualifiers
FT   CDS_pept        188930..189568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0168"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93494"
FT                   /db_xref="GOA:Q5LWW7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWW7"
FT                   /protein_id="AAV93494.1"
FT                   /translation="MSLAPKPTGSESAWLDAAYELLTESGVEAVKIMPLAQKLGVSRTG
FT                   FYWYFKDRETLLEAMIQRWEEKNTGNLVARAEAYAESIVEAMFNLFDCWLDDGLFDARL
FT                   DLAIRNWARNDPGLHQRLDQADQARQDAVAGMFLRFGYPENQARVRSLTVMYTQVGYIS
FT                   MQIEEHPDIRIANMPDYVEVFTGVTPDQADVDRFLSRHAAKWRAAANQM"
     atgtcactgg cacccaaacc caccggatct gagagcgcct ggctggacgc ggcctatgag        60
     ctgttgaccg aaagcggggt cgaggcggtc aagatcatgc ccctggcgca aaaactgggc       120
     gtctcgcgca ccgggttcta ttggtatttc aaggatcgcg agaccttgct tgaggcgatg       180
     atccagcgct gggaagagaa gaacaccggc aatctggtag cccgcgccga ggcctatgcc       240
     gaaagcatcg tcgaggcgat gttcaacctg ttcgattgct ggctggatga cgggctgttc       300
     gatgcgcggc tggatctggc gattcgcaac tgggcgcgca acgatcctgg cctgcatcag       360
     cgtctggacc aggccgatca ggcccgacag gacgcggtgg cgggtatgtt cctgcgcttt       420
     ggttaccccg agaaccaggc ccgggtgcgc tctctgaccg tgatgtatac gcaggttggc       480
     tatatctcga tgcagatcga ggaacatccc gatatccgca tcgccaatat gcccgactat       540
     gtcgaggtct ttaccggcgt caccccggat caggcggatg tggaccggtt cctgtcgcgc       600
     catgcggcca agtggcgggc cgctgctaac cagatgtaa                              639
//

If you have problems or comments...

PBIL Back to PBIL home page