(data stored in ACNUC7421 zone)

EMBL: CP000031.PE165

CP000031.PE165       Location/Qualifiers
FT   CDS_pept        189622..190320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0169"
FT                   /product="transglycosylase, Slt family"
FT                   /note="identified by match to protein family HMM PF01464"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93495"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWW6"
FT                   /protein_id="AAV93495.1"
FT                   /translation="MPLNLITRFAAFVWLSVLFAAAPALAKLDPGVSSLCDQAARSAAN
FT                   RHGVPLDVLRAITRVETGRRSDGQLAPWPWTVNMEGTGHWFPTEFAARKFVFERFKSGA
FT                   RSFDVGCFQINYRWHSQGFSSIEEMFDPERNADYAARFLNDLFGELGSWSAAAGAYHSR
FT                   TQSLADAYASRFDRTRAALGEGPMPNPHRTPDTGGAQPLFARQEAPPGPARLGSLFATG
FT                   SGARPFISFN"
     atgcccttga acctgattac ccgctttgcc gcgtttgtgt ggctctctgt tctgtttgcg        60
     gcggcaccgg ccctggcaaa gctcgatccc ggggtgtcgt cgctgtgcga tcaggccgcg       120
     cgtagcgccg ctaaccggca cggcgtgccg ctcgacgtgc tgcgcgcgat cacccgggtc       180
     gaaaccgggc gccgcagtga cgggcaactt gcaccctggc cttggaccgt gaacatggag       240
     ggaaccggcc attggtttcc gaccgaattc gcggcgcgca aattcgtgtt cgaacggttc       300
     aaatccggtg cccgcagttt tgacgtgggg tgtttccaaa tcaattaccg ctggcacagc       360
     caggggttct cctcgatcga agagatgttc gaccccgagc ggaacgccga ttatgccgcc       420
     cggttcctga acgacctgtt tggtgaattg gggtcctggt cggcggcggc gggggcgtat       480
     cactcgcgca cgcaatccct ggccgatgcc tatgcctcgc ggttcgacag aacccgcgcg       540
     gcgctgggcg aggggccaat gccgaacccg caccgcacgc ccgataccgg aggcgcgcag       600
     ccgctgtttg cacggcaaga ggcgccgccc ggcccggccc ggctgggatc gctgtttgca       660
     accggatcgg gcgcccgccc cttcatctcg ttcaactag                              699
//

If you have problems or comments...

PBIL Back to PBIL home page