(data stored in ACNUC7421 zone)

EMBL: CP000031.PE169

CP000031.PE169       Location/Qualifiers
FT   CDS_pept        194266..194679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0173"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93499"
FT                   /db_xref="GOA:Q5LWW4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWW4"
FT                   /protein_id="AAV93499.1"
FT                   /translation="MVRHSILDQMTRVGEALYLREYERIRAVLEEEARIAAQIARLDDQ
FT                   VVRIRAEGSGDHGYRSVGADILWQSWESRTRRQLNSDLARARAKRLSMMDDLKRAFGRK
FT                   QAIAQIAQDDKSARAKARRKAQLDALTRDAALR"
     gtggtgagac actcgatact ggatcaaatg acgagagtgg gagaggcgct ctatttgcgc        60
     gaatacgagc gtatccgggc cgttctggag gaagaggcgc gcatcgccgc gcagattgcc       120
     cggcttgatg accaggttgt ccgcatccgt gccgaaggat caggagatca tggctatcgc       180
     tcggtcggcg ccgacatcct ctggcaaagc tgggagagcc ggacccgccg ccagctgaac       240
     tccgatctgg cgcgggcgcg ggcgaaacgg ttgtcgatga tggatgatct gaaacgcgcc       300
     tttggtcgca agcaggccat tgcgcaaatc gcacaggatg acaaatcggc ccgggcaaag       360
     gcccgtcgca aggcgcagct tgatgcgctc acccgtgacg ccgcgctgcg ttag             414
//

If you have problems or comments...

PBIL Back to PBIL home page