(data stored in ACNUC7421 zone)

EMBL: CP000031.PE17

CP000031.PE17        Location/Qualifiers
FT   CDS_pept        complement(16689..17132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0017"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC49462.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93348"
FT                   /db_xref="GOA:Q5LWG4"
FT                   /db_xref="InterPro:IPR014937"
FT                   /db_xref="InterPro:IPR036287"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWG4"
FT                   /protein_id="AAV93348.1"
FT                   /translation="MIGEDEFDDDDELEMFVEAQDTVWPDVLRELTLGQKTSHWMWFVF
FT                   PQLAELGQSHMAQLYGIGDLDEAAAYLAHPALRARLIEVSRLMLTHAGKRPDDILGSID
FT                   AKKLRSSMTLFAAVPDAPGEFRAVLEAFYDGSPCPLTLRALGG"
     gtgatcggcg aagacgagtt tgacgatgat gacgaactgg agatgttcgt cgaggcgcag        60
     gacaccgtct ggccggatgt cctgcgcgaa ctaactttgg ggcaaaagac gagccactgg       120
     atgtggttcg tctttccgca gctggccgaa ctcggccagt cgcatatggc gcagctttac       180
     gggatcgggg atctggacga ggcggccgcc tatctggccc atcccgcatt gcgcgcccga       240
     ctgatcgagg tcagccgcct gatgttgacc catgccggta aacggcccga cgatatcctt       300
     ggcagcatcg acgccaagaa gctgcgttct tccatgacgc tgttcgccgc ggtgccggat       360
     gcgccgggtg aattccgcgc ggttctggag gcgttctatg acggatcgcc ctgccccctg       420
     accctgcgcg cgctgggcgg ctga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page