(data stored in ACNUC7421 zone)

EMBL: CP000031.PE170

CP000031.PE170       Location/Qualifiers
FT   CDS_pept        complement(194774..195310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0174"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93500"
FT                   /db_xref="GOA:Q5LWW3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWW3"
FT                   /protein_id="AAV93500.1"
FT                   /translation="MLGKLLPVLFLVVGLGAGVGAGVFLGPKPSQDSAHASDQASDHGE
FT                   EKPSKAKPGDQAKSEPSEDHDAEDSGNEYVKMNKPFVVPLVHKDQISGLATVSLSLEVQ
FT                   PGFSENFYAKEPKLRDGFLQVLFDHANIGGFDGAFTRPGNLDPLRVALLESAQKAFGDN
FT                   IVSVLIVDIARQDSY"
     atgttgggta aactgcttcc ggttcttttc cttgttgtgg gccttggcgc cggggtgggc        60
     gccggggtgt tccttggccc caaaccgtcg caggacagcg cccatgcgag cgatcaggcc       120
     agtgaccatg gcgaagagaa accgtccaag gccaaacccg gtgatcaggc caaatcggaa       180
     ccgtccgagg atcacgacgc cgaggattcg ggcaacgaat acgtcaagat gaacaaaccc       240
     tttgtggtgc cgctggtgca caaggaccag atcagcggcc tggccacggt gtcgctcagc       300
     ctcgaggtcc agccgggttt cagcgagaat ttctacgcca aggaacccaa gctgcgcgac       360
     ggtttccttc aggtcctgtt cgaccatgcc aatatcggcg gtttcgacgg tgcctttacc       420
     cggcccggaa atctcgaccc gctgcgcgtc gccttgcttg aatcggcgca aaaggcattc       480
     ggcgacaata tcgtcagcgt gctgatcgtc gatatcgcca gacaggactc ctattga          537
//

If you have problems or comments...

PBIL Back to PBIL home page