(data stored in ACNUC9435 zone)

EMBL: CP000031.PE176

CP000031.PE176       Location/Qualifiers
FT   CDS_pept        complement(198271..198561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0180"
FT                   /product="flagellar hook-basal body complex protein FliE,
FT                   putative"
FT                   /note="identified by similarity to SP:P24502"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93506"
FT                   /db_xref="GOA:Q5LWX3"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWX3"
FT                   /protein_id="AAV93506.1"
FT                   /translation="MDIRSLSAAQAYASARPATQADPKDDSATQGLRGTFQDFAATLQH
FT                   SEELAQSAMIGKADPHALVQALAQSELAVETAVTVRNKVVEAYQEILRMPV"
     atggatatcc gcagcctctc cgcagcccag gcctatgcct cggcccgccc cgccacccag        60
     gcggacccca aagacgacag cgccacgcag ggcctgcgcg gcaccttcca ggatttcgcc       120
     gccacgctgc agcacagcga ggagctggcc caatcggcga tgatcggcaa ggccgacccg       180
     catgcgctgg tgcaggcatt ggcgcaatcg gaactggcgg tcgaaaccgc tgtcaccgtc       240
     cgcaacaagg tggtcgaggc ctatcaggaa atcctccgga tgccggtctg a                291
//

If you have problems or comments...

PBIL Back to PBIL home page